SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023221 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023221
Domain Number 1 Region: 96-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023221   Gene: ENSORLG00000018574   Transcript: ENSORLT00000023222
Sequence length 176
Comment pep:novel scaffold:MEDAKA1:scaffold2185:10320:10847:-1 gene:ENSORLG00000018574 transcript:ENSORLT00000023222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPASHSPHLYPQDGFKMEPMASDMLQQEAYSLEEPPETSVSHRPKPQRRSSSRGAGQAV
CRCPNCVHAEQMGQSPDDSRRKHMHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWL
FCGKRFTRSDELQRHLQTHTGAKKFSCALCPRVFMRNDHLAKHMRTHESPPGQGEE
Download sequence
Identical sequences H2MWH5
8090.ENSORLP00000023221 ENSORLP00000023221 ENSORLP00000023221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]