SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023332 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023332
Domain Number 1 Region: 83-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.94e-21
Family Hermes transposase-like 0.00099
Further Details:      
 
Domain Number 2 Region: 20-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000069
Family BED zinc finger 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023332   Gene: ENSORLG00000018670   Transcript: ENSORLT00000023333
Sequence length 182
Comment pep:novel ultracontig:MEDAKA1:ultracontig72:787986:790987:-1 gene:ENSORLG00000018670 transcript:ENSORLT00000023333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWVCRMEFCLIMDLPRKFSPVWNNFDLVTPNKVRCRLCSTELSYINKSTLSMLRHYRAR
HGNEELADTRESTPGHILWKTLDLEVAETQKTRNATADSIIEVQRYLAETNTPRNQDPLL
YWKWNQEIYPHLHQLALKTLCSPSSSVPCKRVFSKAGELVCKRRNRLGAKTLQKLLFLNK
NS
Download sequence
Identical sequences H2MWS3
8090.ENSORLP00000023332 ENSORLP00000023332 ENSORLP00000023332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]