SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023464 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023464
Domain Number 1 Region: 18-280
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.15e-80
Family Eukaryotic proteases 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023464   Gene: ENSORLG00000018786   Transcript: ENSORLT00000023465
Sequence length 284
Comment pep:known scaffold:MEDAKA1:scaffold402:324545:328042:1 gene:ENSORLG00000018786 transcript:ENSORLT00000023465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAFVVTRLFVPGDWPQDCGMAYFKPNMAERIVSGNEARPHSWPWQVSLQVRPRGSKHYVH
VCGGTLIHKNWVLTAAHCFQKGKAEDAGSWRIVLGKHQLKRSETAERIFPVKRIYRHESF
RYPTHSELDYDIALVKAGTDIPPSNFIRYACLPRKQTGLRPGHYCWVTGWGDTRGGKDNV
SLAEALNQARLPIIDFKTCRQKKFWGDRVRDSMICAGFRDTEDPPAACQGDSGGPLLCQL
DRDRWEVHGVVSFGPIGCTVENKPSVFTRTATYIPWIEATRIRD
Download sequence
Identical sequences H2MX24
ENSORLP00000023464 8090.ENSORLP00000023464 ENSORLP00000023464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]