SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023485 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000023485
Domain Number - Region: 532-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0445
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023485   Gene: ENSORLG00000018803   Transcript: ENSORLT00000023486
Sequence length 1328
Comment pep:novel ultracontig:MEDAKA1:ultracontig72:1081501:1104993:-1 gene:ENSORLG00000018803 transcript:ENSORLT00000023486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKEHVKNSKDTIIIELVFKMSCRSSPPGGKSVDSSAVDTYDSGDEWDIGVGNLIIDLEA
DLEKDKLEMSINKEGGAAAAPSGAVAALPNNIKFVSPSAAMHCKDGKSRSKRVKSSKDGS
KFLVSDGAKREVQGRAPVDPPPQSPTSLLTKGGDKSSKNSRTLPTVKKEVVCGKSKKDKT
ETTAAKAVKAEEESGAAAPPLGTPHNSQFAGQQNLELGADPDGQRLXGHSARSNAFSASI
VITHSGTSSGADDLMAATISASNMGSSNFFRESSEIAGISRLLKKLLIQQIRPLDPMDSP
VSTSAPPPLHLLGPLTNSNDISSACEQIMVRTRSVAVNTAETALATEPDCLGPCEPGTSV
NLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTRHDWAPPRFCDSPTSDMEMRGGRGRG
KRMRSGSNVPSNESSSTFDSKGSKTRSAAASSKGKRSSQAASSTDDAKASPSSAKRRTKP
VSDVEPTSSSEDSKVSKRMRTSPAGGKTDPQFPPQLEQSCPSPVLIDCPHPNCNKKYKHI
NGLKYHQAHAHNDLDVRLDQDGDSEYGEDPVLHPDLGSCGTSGLSPASCITPKGRGFDAP
LPSLRLSKVKKTAGEPESQGTDGGEEEACLTDEASNDGVDDRKARKLAGSGKTEKVTQRA
GKLGRPGTHTSPGPTSMYSLQSSPPAVGSVVQCVPSSPQSKTSQPKAASLADTVALSKDK
KKRDKKKKDGWREEDGPYAVNKAAKSEEAKGLYSETSEALLNGCVEVQQSRLASMKAEAD
KVYSFSDSAPSPSLGMTGRVEPGLVPPLHLNQNGGDNLSVKTSSPAYSDISDVGEDGEGK
ADGIKIKQEPDQGPHEGAKKALFSPQGPRKESHFYPSYDSYYSPNYPSRSPGVAPAPPPH
GEDTQVKVKKEEDLDVREEAKLKVEPPEESKVEMGNQQPSVIQQRSNLYSHPLYYNQYYV
PPYSYPPDPAYHAQLLASNPAYRQQYEDRQRQADRKGEGRDQEVSVKEEWKQKALVPPTQ
SNPSLTDLGAKMGLSSSKAKDAAAASDQAKSAITPKGEDPKVPAAQGEGIKVKPNEARYH
GTEEVKPGVEVGRPAAVDPAMWYRQQEADSRLWSYVYPSKYSEALKAQEEDRWKEERERR
GREERQRPNDGVQKEAGKEGADGRAQPLPEEHQDRGREMRFPHMQFPSALPQHQAYMPYL
QGPYAYSQGYEPSHPGFRGMPSVVMQNYPDAYLPAGYAFSYGGKAAVGEDGEKSSRSSPA
LKPSSEAKALDLLQQHASQYKSKSPSTQDQKNPHERERDAARPRSSPSQRLLPPHHHVGY
PLLSGQYD
Download sequence
Identical sequences H2MX44
ENSORLP00000023485 8090.ENSORLP00000023485 ENSORLP00000023485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]