SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023557 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023557
Domain Number 1 Region: 343-403
Classification Level Classification E-value
Superfamily Leucine zipper domain 6.75e-17
Family Leucine zipper domain 0.0000942
Further Details:      
 
Domain Number 2 Region: 3-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000908
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023557   Gene: ENSORLG00000018868   Transcript: ENSORLT00000023558
Sequence length 497
Comment pep:novel ultracontig:MEDAKA1:ultracontig62:329554:338201:1 gene:ENSORLG00000018868 transcript:ENSORLT00000023558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDDRPFVCTAPGCGQRFTNEDHLSVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELASSFEQEFCKSQDDEQRTKPPVRTNHEQHIYHSVGQTPSEVKEEDEGPLQ
VDSSPPGSPDSSSSMSENSGDSGVRGQEMITKPLASSAPTPTIVRPGSLPLHLSNDALHP
TLPSPTSVITQAPPSNRQLGSPTSAYSLMRHLPNGQTVPLLPSPVQMTSVISLARPVNTV
ANIPGIPGPPVRGISSGSSSPSEFSLHSETKMRLKAALSQGPSAPDGAGIGSGSIPAVPQ
RQEESQQPTPNSDAPSPAQPQVSPAQPTGGRRRRAAEMDPDERRQRFLERNRAAASRCRQ
KRKLWVNSLEKKAEDLANMNVSLTSEVTLLRNEVAQLKQLLLAHKDCPVTVMQKKAAMLA
AGGEEHHGGISTEPVGSAAGVIQHGPSPPASASSPRATINGLNVRAAEAVAMSVLAGMGS
GQAGGVVMATQSQQSPR
Download sequence
Identical sequences H2MXA3
ENSORLP00000023557 8090.ENSORLP00000023557 ENSORLP00000023557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]