SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023602 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023602
Domain Number 1 Region: 66-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023602   Gene: ENSORLG00000018915   Transcript: ENSORLT00000023603
Sequence length 126
Comment pep:known scaffold:MEDAKA1:scaffold790:58046:60700:1 gene:ENSORLG00000018915 transcript:ENSORLT00000023603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPTYEEDENNKADLKNQQSFNVTDSQDEEGNQHEESTSTTDEGTESTSTRDGDTDPQN
RDLKKSFSYLSHLKTHMRTHTGEKPFSCKECDKRFSHVSDLKKHMRTHTGEKPFSCKECD
KNFSFA
Download sequence
Identical sequences H2MXE0
ENSORLP00000023602 8090.ENSORLP00000023602 ENSORLP00000023602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]