SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023681 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023681
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000295
Family MBT repeat 0.03
Further Details:      
 
Domain Number 2 Region: 89-136
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000602
Family Tudor domain 0.014
Further Details:      
 
Domain Number 3 Region: 638-695
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000908
Family PHD domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000023681
Domain Number - Region: 440-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00061
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023681   Gene: ENSORLG00000018975   Transcript: ENSORLT00000023682
Sequence length 964
Comment pep:novel ultracontig:MEDAKA1:ultracontig88:489293:504811:-1 gene:ENSORLG00000018975 transcript:ENSORLT00000023682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMKTPPDRSGIKFEVGAQLEARDPHKKWYPATIERIDYEKEQVLIHYRQWSRRHNEWFQW
NSPYLRPLERVSLRRQGLSPLQSTPMFVTGTKVLACWTDCRFYPAKILRVNKDESYTVRF
YDGVVRTVKPAKVKPFQRKPRAERNAVGKTKGDEGAQEKMEFEGTDEAEGGKREQDTPPP
YSDPPPKKKPDDGKSEICQILAFIIEKTVLFAQTQFQLFSMYNICENEHNEDHKSLKNKG
SELCLVGLDDPTPNIKVPRIAQGLPSVPLYSIKQATFTEVLGGHVLRRFKVESAAERVEP
VSRVSAALQMDADARDRTSRSASEELRSVRLTYPPHTSSAESPVSPHKHCCSIHTSDTLK
LFHLEIPYKLSLSGFTGRIKNTLLFHYLSILLWSEDVKRLSALICGQRGFLLFTEVKNCL
VLSVYRVIKNQPPPILSIELDHNPFKCPSAGCSKSFRKASLLHYHIKYYHSDQQLDGGSG
APEAARRKRSSSEGGDFVSSRRMENQSSSCYRDDTEQSILGNETTAISEGPKRTQLKIMA
SADRDEEGENRRTGPEGEEALPKSKNLQPPHSSECTFFRFKVLSWTPDLDGWERRNLTRE
NLLLSPRSVPDFSQMDEGSDWSTLTAESGEDTPFWPASMETDDCEVVRCVCEVDEENDFM
IQCESCLCWQHGTCMGLYEDNVPHNYICYYCRQTAGWRRAQHFLSETDWLISGHMFGLSC
VKENYAQINGSKISHTRHLLAHTYQISQVLSGLQLKISLLHSPSQADLQLWRLPWRQEEV
ERHMSSPKGQPPVCYVSSEHCYQKPGASWEKAEEQNERTATEGSKLDMLCVQRCSSADLG
WNHEQETNPEDVAQQLCDTTTHSYVNNNLSIKQEALPHVEIGPPTHSASVSECQLNLLDH
VEFLHQQISSRMDLIERELDVLESWLDHSGELEPPDPLSRLPQLKLRIKQLLSDLCVVRH
LSVC
Download sequence
Identical sequences H2MXL3
8090.ENSORLP00000023681 ENSORLP00000023681 ENSORLP00000023681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]