SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023794 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000023794
Domain Number - Region: 372-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000366
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 735-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0033
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023794   Gene: ENSORLG00000019081   Transcript: ENSORLT00000023795
Sequence length 1018
Comment pep:novel ultracontig:MEDAKA1:ultracontig49:797045:803803:-1 gene:ENSORLG00000019081 transcript:ENSORLT00000023795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRFSFLNSQVICCTLGSCNCDGFKPGKLKRRQCENCKHGWVAHALSKLKVHHLYQSSQVE
IVHSNVVFDICSLMLYGTQAIPIRLKILLDRLFSVLKQEEVIQILNALDWSLQDYIRGYV
LQDAAGKVLDRWAIMTFEEEIATLQQFLRFGETKSIVELMALQDKEGQAVLVPSTRTNSD
IRTFIERNTPRTSANLSTSKLEKTGSNSMHHFENFLNSMAFMLPFQMLGSVQAPFLGAQA
GTVQQHYQQTRDISMESQRRADQDLRRDAPLPLSLSSENSRLGSNSISFSADVDQSGETL
TEGISPPTKIESEDFSASDNYSDGPSTPCTPSMSSDVMQMSPEVKLRSLDRNGGGGGGAS
SGGGSLKKGRVFCNACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRNRHS
ANPNPRLHMPMNRNNRDKDLRGSLSADESSQGEKRPEYNSSFSICSSESHKSAPSYMVSN
ADPGPKLHSSTFPSVGQSGILFPNLKTVQPVLPFYRSLVTPAELANTPGTLPSLPLLSSS
VPVKPACLADPIPKKKSRKSSMPIKIEKETIEQDEQMDKESSSEDELPSQGEVKRRPIEE
HMSTEQSGEEKQMAKCTLDQTLDRDTTDKEDNEERHAETNHSLSPTFENRLIENHCDNFL
SQESNGGEERTSKENAKSPCGPEKIPDLKGDEEDYRLTNRVGLQSIERGGLDKCDHSDTS
MTHRDPPADLTLPPHCEICNKNFKDQFSMKMHYQNAHLKDMHKCTVDGCNATFPSRRSRD
RHSTNLNLHHKLLTKDSLNPASSLYLSSSFCRNRESIDLEQRDRDLPRDPSCQTSVIFRG
HNRMGLVFPMSKTPAAQSTESSPKGEMEELGRGERNTSADDGAVLDLSTSAAAPPCVSSS
AQLSWDSDGVGSEEGEGPEEDEEVIPMEDSDESCDGNNEVRLDDDELTLSGERSLGCGGG
GQSGFHAHYKTVHLRLLHKCKVPGCETSFSSVRSRNRHSQNPNLHRNLSMSSGPTVGQ
Download sequence
Identical sequences H2MXW0
ENSORLP00000023794 8090.ENSORLP00000023794 ENSORLP00000023794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]