SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023987 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023987
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily POZ domain 1.02e-18
Family BTB/POZ domain 0.0034
Further Details:      
 
Domain Number 2 Region: 296-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000244
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000023987
Domain Number - Region: 272-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000587
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023987   Gene: ENSORLG00000019255   Transcript: ENSORLT00000023988
Sequence length 358
Comment pep:novel scaffold:MEDAKA1:scaffold3535:4042:5307:-1 gene:ENSORLG00000019255 transcript:ENSORLT00000023988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSSDTLHFSFPTYGDSILSKMNVLREEHQFCDITLHVGTPKDGLPVHFHGHRVVLAAS
SDFLRDQFLLHEGQAELSVGVVSSGRVAESLFLSCYTGILEIPLRELVSYLTAASALQMS
QVVEKCTEAVSLYLSPTLTFLKQKLSRSWLDSSCDDQKEKDEVQSRNQEAKQEGVSPRGG
QQAGQKLRDSKEKMQLTEVALESEKGTTVSKIRGSPGEEQQHEEEEGAEGRNNSLAEQHQ
PDEDKTLSGEDTAKSHMTAEDVSEDPEKTLLQRPYLCRKCDKVFQHLESYMDHVKESKEH
FCLVCKKSFSGKGNLSRHICTYTAAKPFRCPLCHKTFTKKALLQDHFHLHTRESPRKC
Download sequence
Identical sequences H2MYB0
ENSORLP00000023987 8090.ENSORLP00000023987 ENSORLP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]