SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024023 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024023
Domain Number 1 Region: 356-579
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-48
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 584-715
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 3 Region: 114-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-16
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024023   Gene: ENSORLG00000019281   Transcript: ENSORLT00000024024
Sequence length 1025
Comment pep:novel ultracontig:MEDAKA1:ultracontig85:411212:439450:-1 gene:ENSORLG00000019281 transcript:ENSORLT00000024024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKGCKSGVCHHPDCQDQNNKSPLHLCESCDSRCHSENNMHFDRHPRFDLQPQVQASILA
RNVSTRSCPPRTSPPSDLEEEDEGSNDHGERKSVGMKLGKKKQRRRHTDDPSKECFSLKF
DLSVDISTEIVPAVKKKTLREVLGPVFERNGIELSRVDLFLDQSNTPLSLNFEAYHFGGH
YLKVKAKPGDELKVEQGVKDMKSLSLPIMKPSGSPSPYILTPVGESLALRESLDLLGQAR
QRKNMTKFLGENIIPTPDSLGQLGGSLPSVGPGPDRWKNRAASRFSGLFGSNAGAGSFEK
EVDRLEQLQSKLDSYSKYGLPKVPWQLSFHQDSWEEEEEEANLILEDSWKELLDGPETLT
RRQFHQQEAIWELLNTEAAYIKKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIV
RLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIRYCMEEESCMEYMRT
LLRDNELFRKYITNQWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARD
IVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFD
LMAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEKVKVIRQ
PLLIHNIVCKELKDPGSFILIYLNEFNSAVAAYTFQANSATQGRCWIDAIYNIQNQLQRL
RSEEDLRRQQRPRSCSGVDVDDESSNSTTSSPILQHKEQQNSSHSDGSTETLSVMDMEER
SEPPPPPSINIEEPGDKSPLSDSSDLQSSPQLNGLEVEGLDAQCRSLSMDSAYGTLSPGS
LSRELQPPPGPTALGSQASVALSSKPRRRPHIQSKLQCPQRLSALSRSEDNLLQRFHGDA
PISHAHLAHSRSLSELCQDGEDSDLGQSDDGLSMSLPSNELRARLSRGTARHRHKAPSGS
CEFAGSDLVSTPPGCLVKTANDDSGETPPIKRKSSPQQHKKLTLAQLYRMRTTLVLNSTL
TASEV
Download sequence
Identical sequences H2MYE3
8090.ENSORLP00000024023 ENSORLP00000024023 ENSORLP00000024023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]