SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024138 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024138
Domain Number 1 Region: 102-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 46-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000024138
Domain Number - Region: 153-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0053
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024138   Gene: ENSORLG00000019388   Transcript: ENSORLT00000024139
Sequence length 187
Comment pep:known scaffold:MEDAKA1:scaffold4937:1780:2963:1 gene:ENSORLG00000019388 transcript:ENSORLT00000024139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTHTGEKPFSCQECDRSFSDGSYLKTHMRIHTGEKPFSCKECDTSFSDGSHLKKHMRTH
TGEKPFSCKECDKSFSQITHLKTHMRTHTGEKPFSCKECDKSFSNTSDLKIHMRTHTGEK
PFPCKECDKSFSQISHLKTHMRIHTGEKPFSCQECDKSFSQISHLRKHMRTHTGCAREVE
PRLKICG
Download sequence
Identical sequences H2MYP2
ENSORLP00000024138 8090.ENSORLP00000024138 ENSORLP00000024138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]