SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024319 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024319
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 82-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000759
Family Hairy Orange domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024319   Gene: ENSORLG00000019546   Transcript: ENSORLT00000024320
Sequence length 229
Comment pep:known scaffold:MEDAKA1:scaffold461:265394:266812:-1 gene:ENSORLG00000019546 transcript:ENSORLT00000024320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKMKDRKRTPISHKVIEKRRRDRINRCLNELGKTVPMALAKQNSGKLEKAEILEMTVQ
YLRALHSADFPRGREKGELLAEFANYFHYGYHECMKNLVHYLTTEDRAETKDIKYARILA
FLQSKSRVVTEPVFGSVGAIAEPSDFLSQLHSSSEHQSHSPSEYQQSPPGVFSWPGSARS
QSISYPTVPLSAHTQQHGGYLSPGLDHHYFNLIGHTHTNAFSLHSAQHA
Download sequence
Identical sequences H2MZ42
8090.ENSORLP00000024319 ENSORLP00000024319 ENSORLP00000024319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]