SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024410 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024410
Domain Number 1 Region: 146-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000165
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024410   Gene: ENSORLG00000019628   Transcript: ENSORLT00000024411
Sequence length 196
Comment pep:novel scaffold:MEDAKA1:scaffold1168:1420:9966:1 gene:ENSORLG00000019628 transcript:ENSORLT00000024411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFKSDLLDHQHHQRKITMIPVIKLERIDPSEKNICKEETDDEQLLWKQERSSSLDEEKP
ELPLIKEEWEEVCIGEEGEELELKEETDDFMVTEDDQENMDSNPEPIENPVLEANSQFRN
SDAVIVQLDSPSDSHVKESSAVLCQSYSCDTCGNILPQHSDSIHTSERPYSCNVCEKSYS
QSSTSKAHMKTPTGKK
Download sequence
Identical sequences H2MZC0
ENSORLP00000024410 8090.ENSORLP00000024410 ENSORLP00000024410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]