SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024520 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024520
Domain Number 1 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 282-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 205-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000324
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 4-58
Classification Level Classification E-value
Superfamily POZ domain 0.0000628
Family BTB/POZ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024520   Gene: ENSORLG00000019731   Transcript: ENSORLT00000024521
Sequence length 373
Comment pep:known ultracontig:MEDAKA1:ultracontig236:2079034:2084277:1 gene:ENSORLG00000019731 transcript:ENSORLT00000024521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVDNSSVIEIDFIRSDIFEEVLNYMYTARISVKKRDVNLMMSSGQILGIRFLDKLCSQKR
DVSSEEKDKFPFDIVKMALPPEAQLAADSEVLDEQDDTPSGDELEDTSASQELDKSPSAA
LRVQEAILKELTNEDVHKVSCYDQDVVSEMETEPKDLGTEHHATQTLAFADSIGDVKDEQ
APGWSTAAGDMKFEYLLYGHREQLACQVCGKTFLDESRLRKHEKLHSAERPFTCEICTKA
FTTHAHLKEHLKIHTGFKPYRCDVCGKSFIRAPDLKKHERVHSNERPFACQMCEKAFKHK
SHLKDHERRHRGEKPFVCPSCTKAFAKASDLKRHENNMHSDRKQLNPLQSETEALQAAAM
AAEEQHLENISCS
Download sequence
Identical sequences H2MZL2
ENSORLP00000024520 ENSORLP00000024520 8090.ENSORLP00000024520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]