SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024789 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024789
Domain Number 1 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 97-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 210-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 45-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 370-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 3-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000154
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 337-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024789   Gene: ENSORLG00000019966   Transcript: ENSORLT00000024790
Sequence length 578
Comment pep:novel ultracontig:MEDAKA1:ultracontig29:10446:94999:1 gene:ENSORLG00000019966 transcript:ENSORLT00000024790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDRLMSCKECDKSFSRMYNFQRHMKTHTGEKPFSCKECDKCLTDASSLKTHMRIHTGEKP
FTCTECDKSFCHVSSLQAHIRTHTGERLFACKECDTSFRHLSNLKRHMRIHTGENPFSCK
ECGTRFSDVSNFKTHMRIHTGEKPFSCKECDTSFNQISHLKTHMRTHTGERPFSCKECDA
SFSRICNFQRHMRIHTGEKPFSCKECDKCFSDLSTLKTHMRTHTGEKPFPCIECDKSFRH
ESSLQAHMRTHTREKPFACKECKKSFRHKFDLKTHIRTHTEEVKSLVCVKCRKTFVEDEE
LKTNMRHTGEKPFSCIECDKSFSQTSHLKSHMRSHTECDKRFSHVFTLKKHMRTHTGEKL
FSCIECDKRFSHVFTLKKHMRTHTGEKPFSCVECDKRFSDSSSLQKSLRTHTGEKPFSCK
KCNKSFSFVFNLKTHMRTHTGEKPFSCKECDKSFSEKSKLKIHMRTHTGEKPFSCKECDK
SFSEKSKLKIHMRTHTGEKPFSCTECDKRFSQLSNLKNHIRTHTGEKPFSCTECDKRFSE
MSSLKKHMRTHTGEKPFSCKVCKKKFNQTSSLKTHMKT
Download sequence
Identical sequences H2N096
ENSORLP00000024789 ENSORLP00000024789 8090.ENSORLP00000024789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]