SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024790 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024790
Domain Number 1 Region: 79-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000277
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024790   Gene: ENSORLG00000019967   Transcript: ENSORLT00000024791
Sequence length 170
Comment pep:novel ultracontig:MEDAKA1:ultracontig62:1424301:1435780:1 gene:ENSORLG00000019967 transcript:ENSORLT00000024791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDHLKKHSEGAHNYCGICNKDGQEDDRKCPHLDSEESDASFREMSNGDELKSPHKSDCN
GASAELLASPDGSKSKAEPEKRFGCDICGQAFRTKSYLNKHQHRVHKAQRPHGLSGSGLS
DMASALTSPFSLQQNMSLLESFGFQIVQSAFASSLVDADAGQSGIDFGGK
Download sequence
Identical sequences H2N097
ENSORLP00000024790 8090.ENSORLP00000024790 ENSORLP00000024790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]