SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024955 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000024955
Domain Number - Region: 61-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00306
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024955   Gene: ENSORLG00000020110   Transcript: ENSORLT00000024956
Sequence length 143
Comment pep:novel scaffold:MEDAKA1:scaffold2713:4223:11175:-1 gene:ENSORLG00000020110 transcript:ENSORLT00000024956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLADLNGAGRKSCPLCSEEKFKACYSHKLRRHLQNLHWKVFVEFEGFRMCICHLPCRNLK
PGISGDQASGRHVAHYHCVVCSVTIARKTDMISHLKRHVNKGETEASYSGSLDVQFEEPT
PSGQAYEIMKELGTNVQLLPNYS
Download sequence
Identical sequences H2N0N9
ENSORLP00000024955 ENSORLP00000024955 8090.ENSORLP00000024955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]