SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025012 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025012
Domain Number 1 Region: 877-929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000364
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 156-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000547
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 840-892
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000405
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 89-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000083
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025012
Domain Number - Region: 504-550
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000513
Family Homeodomain 0.024
Further Details:      
 
Domain Number - Region: 436-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0615
Family HkH motif-containing C2H2 finger 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025012   Gene: ENSORLG00000020157   Transcript: ENSORLT00000025013
Sequence length 997
Comment pep:novel ultracontig:MEDAKA1:ultracontig247:115709:133896:-1 gene:ENSORLG00000020157 transcript:ENSORLT00000025013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSYPTLVTHSAKPLDRGSKPNDYFLKEEFEDSDDDSAAIVEYLQRSDTIIIYPEAPEEAK
TLRTAEATSPKENKHGSLSDPTDDFAQLLTCPYCERGYKRLTSLKEHIMNRHKRNDESFA
CQLCTGTFDSSSLLDRHMTTHKLGREKPPPLSEEAENRKFKCSECGKAFKYKHHLKEHLR
IHSGEKPYECSNCKKRFSHSGSYSSHISSKKCIGLLTLNGQVHNGNFSKSCSFPRSRTLS
PESPTIPRLHPKLENGQPLFSQIQQGQPHVRGEPNYLSDYHLLMASQHVFEGTRVYLNGH
GLSSLGIHSSPQSSLSHLGSMEVDLPLLSYTGPPVSSLSEVQKLLHIMDNNGCRQNPEKM
SQMKAYMKELEAQIQAQAGFPAVTHSSPTRSITDYTLKKVREAKSLINKEKKQVRDKKEK
SNHSGFLCSEEKSLDEQTLFLPFCCQFCKQTFPGPIALHQHERYLCKMNEEIRGVLEPAE
NLLSGRQRTLVDELSLSNGATSPTHLLKDHFSVLNACFAVNTEPSIEEVGKLSHAVAGPQ
EFVKEWFANYESQNHQMGSVRKKSLLPNHSAHDHHLGHSPKSLLTVDMHCGLTNGNSSQK
PEKTNHFGASRQPAGVMPHELPDILKDNTLSPLNLSNFPSHSTFSKNSQIRSNTPSSLIS
EETLWDIPLDLSLPRNVKQKLVSVAEKQVRPKGLMPECNVKLAEKEQACVPSDLISVKTE
VLDSDIKGNFGHQPENSASPLFGIDPFYGGSAYTPLSPHGAFTPPTFRSSTQSTNVGLRG
FSGLNPMSLLPHMAYTYTAGTTFAEMQQQKYQHKPSFQGELLDKTADYLSGLDNLTDSNS
MLSRKKIKKTESGMYACDLCDKTFQKTSSLLRHKYEHTGKRPHQCQTCKKAFKHKHHLIE
HSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREADEREAAEREAQEQGVSGLL
NGGLEPSERMMGTTYLQKLEPLGSLQPNDQEEPCNNV
Download sequence
Identical sequences H2N0T8
ENSORLP00000025012 ENSORLP00000025012 8090.ENSORLP00000025012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]