SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025372 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000025372
Domain Number - Region: 122-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00191
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025372   Gene: ENSORLG00000020479   Transcript: ENSORLT00000025373
Sequence length 253
Comment pep:known scaffold:MEDAKA1:scaffold1526:18207:19996:-1 gene:ENSORLG00000020479 transcript:ENSORLT00000025373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDMERWAKIQNQKKESCRAPSPVLKSGMEDDKRQSKSADVAFAVFERKISGSEDPFKKP
VAPAKKDEKSKRPIGSLGLLASDYAAGSDEEVEEDNEEAAKVSQPCRPEEKDDKLTDWKK
MACLLCRRQFPNKDALIRHQQLSDLHKQNMEIHLKIKRSKKELEALENQEKELNAREVSR
SPEPKRKKHHHQQVQHQNTWARSSRDMNKVSERPGLGAEPVQQRKKKEPVVWDHATYKQA
VRKAMFARFKELD
Download sequence
Identical sequences H2N1Q9
ENSORLP00000025372 ENSORLP00000025372 8090.ENSORLP00000025372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]