SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025450 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025450
Domain Number 1 Region: 364-447
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000099
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 273-345
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000204
Family Canonical RBD 0.002
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025450
Domain Number - Region: 152-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000667
Family HkH motif-containing C2H2 finger 0.071
Further Details:      
 
Domain Number - Region: 740-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0595
Family HkH motif-containing C2H2 finger 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025450   Gene: ENSORLG00000020540   Transcript: ENSORLT00000025451
Sequence length 785
Comment pep:novel ultracontig:MEDAKA1:ultracontig115:4096407:4108693:1 gene:ENSORLG00000020540 transcript:ENSORLT00000025451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFASLGLSPSDLDALAEIPEDEISVETLPRILMQLKSRKGEAGERRAVSSMSSEAAFQ
GGRDSWEEGRMGRMGGPSMGEGPARSKPSADFGYSSMQNMPTGRGLGSSFNSGGGGRGDR
PYPELSHQTSYGGLDMGPSQSDSIFMQRRIGSPSVGKVQDFLGVMPSMFPHVCSLCDFDV
HSTMEWNQHVCGLRHAENRRLLLDMYPDWDPSLSPGRGGRRDTPNLSAGLLGPAPMSSAG
MSSSWGHTFNFHLMIWKKSKNLENFTVQFQMRSRVVVVKYERKPLSNKTLFAFTEPFGRL
REHLVLKNKAFLEMSSHEEALDMVNYYKQHTASLYGKPITFYLSQRLMFIEKDPQMSEGM
GDRPMRDVKSHGSKVVFFSNLPREEEKKRELLTIAGRFGTVDKHLFLTDQAFVQLGTVED
AEMLVKYYSVNPLTIRGRLIRLNICTKYKTLNVNRRQSGSAEETSTRRRSRTRERSSSPA
AKSASRTASSKSTSRTGVVQGAEDEEEDHASDKDPKEEDSEKETVVKDVKTDEEQEVPDD
VTPVEEAEPEAKQEVEPEGAAETSLEESELKEEAVESGNTMEGDVPAEELNKHLSNHALL
RKQLDQDFMENMEDFVTLDELEEDEGDAPDNSKKGQKENSLASVPEMMEMTLLLGSGLVF
LGCSITKRTSSPPPKSSEELPAKKEKREEQQQDEEMETSTNQNGQTETPPPVDTKPSSAA
LPLPPYDPETPVGVEHVKMGYYCRICFLFYTNENTAKKTHCSSQAHYDKLQVVMSLFQKY
LEKEQ
Download sequence
Identical sequences H2N1Y5
ENSORLP00000025450 ENSORLP00000025450 8090.ENSORLP00000025450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]