SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025471 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025471
Domain Number 1 Region: 54-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 95-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000178
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 371-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000269
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025471   Gene: ENSORLG00000020562   Transcript: ENSORLT00000025472
Sequence length 427
Comment pep:known scaffold:MEDAKA1:scaffold1046:29829:43376:-1 gene:ENSORLG00000020562 transcript:ENSORLT00000025472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEEAQEIAQMPGRDSPPANEASEETEEPMAVPEDLSASSAHQQNNRGDKGERPFQCSQ
CGASFTQKGNLLRHIKLHSGEKPFKCHLCSYACRRRDALTGHLRTHSVGKPHKCGYCGRS
YKQRSSLEEHKERCHNYLQCMGLQNSIYTVVKEESNQNEQREDLSQTGSDRALVLDRLAN
NVAKRKSTMPQKFVGDKRLSDLSYDGAAGELIQPHVIDQAINSAISYLGAESLRPLVQTS
PASSDVGLSSLYGLHKPASESHTGTALSAKDSAAENLLLLSNSKSASSEKDGSPSHSGQD
STDTESNNEDRPAGAASGLIYLTNHITSGVRNGVLPLVKEEQQRQYDALRANMEMASEGF
KVVTSDGEQVRAYRCEHCRVLFLDHVMYTIHMGCHGFRDPLECNLCGHRSQDRYEFSSHI
TRGEHRY
Download sequence
Identical sequences H2N206
ENSORLP00000025471 8090.ENSORLP00000025471 ENSORLP00000025471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]