SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025674 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025674
Domain Number 1 Region: 1105-1162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 1684-1736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 184-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-16
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 900-952
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000226
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 938-993
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000528
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 1147-1199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000648
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 657-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 11 Region: 1634-1699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000352
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 56-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000365
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 13 Region: 24-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000777
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 14 Region: 163-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000041
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 15 Region: 1598-1648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000142
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 16 Region: 100-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000606
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025674
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00404
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 241-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0717
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025674   Gene: ENSORLG00000020729   Transcript: ENSORLT00000025675
Sequence length 1743
Comment pep:novel ultracontig:MEDAKA1:ultracontig182:2117038:2213946:-1 gene:ENSORLG00000020729 transcript:ENSORLT00000025675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCTICSQIFTTESQLQKHHREHETNDKPYRCDQCPQTFNMEFNLTLHKSTHTTSDFTCPV
CNKKFSRIASLKSHVMLHEKEENLICTECGDEFVLQSQLSLHLEEHRKELSGVKVYTCKR
CSREFQTSAQIKEHMRSHIKIRPLSSSSRNYKKSIDRSGFTNSCHHCGKAFKKPSQLVRH
IRIHTGERPYKCSHCGKAFNQKVVLQTHMVRHTGEKPHLCIFCPASFSQKGNLHSHVQRV
HSESKGVPLFPCMDCSCVFKKLGSLNAHISKMHISVIDVPSGASVRKTHIFILSLFRTCP
CLETETAGQAAGGSEGGEAVTDVIQQLLELSEQVSGETAQPQPPEPAITMETAINQDILQ
QALENSGLSVVPPQSDAASREPQSQSSENSAAEVEKVQSSDKPAREKRRSIFKKPIQMPG
SIREEDGVRWHGCPYCSKEFKKPSDLVRHIRIHTHEKPFKCKQCFRAFAVKSTLTAHMKT
HTGIKAFECQCCLKCFSTSGSMKVHMRLHTGVRPFSCPHCDKIFRTSGHRKTHIASHFKS
SQQKKQKFPRKSNKAKVSKSNLRLPEIPLQEPILITDYGLVTSQNPRLAFQQYLEVVGSD
RPYKCQFCSKAYKKSSHLKQHVRSHTGERPYKCVQCSRGFASSGVLKAHIRTHSGLKAYK
CLMCDTTFTTSGSLRRHMTTHSDLRPYMCPYCQKTFKSSPNCRKHMKTHRYELAQQLQPQ
SGEDPLGAGAVAHDIAVEMDPEPLQQPVATTAEQQGMLGLTQAEVVNGGQQVSLEAPLTD
QTLVQGEDSFVTSQHSLPQNISQFEPPALPQPPFDQQALTQGFSISESSYSQAQFSTVQQ
LQDSSTLESQALSSSYHPPNLLHVSGAEATNGLLQPNSQNELQLTETPDFQEDSEENSKR
AYRCSWCNKGFKKSSHLKQHIRSHTGEKPFRCPLCGRAFVSAGVLKSHLNTHTGVKPFRC
DVCDASFTTNGSLSRHMIIHMKSFKCSMCDDTFRTSMLCKRHMKKEHGVEEQSKDGLDTQ
DGEEEDDDEDGELKASKRRGLEIITFTEEQTAELAKDPGEEASVSERILAQSAAERDRIS
EIKDKAVELETEPKFANCCNYCPKSFKKPSDLVRHVRIHTGERPYKCDECGKTFTVKSTL
DCHVKTHTGQKLFSCHMCNTSFSTKGSLKVHMRLHTGSKPFKCPFCELRFRTSGHRKTHI
QCHFRPSIDSRKSKRSASSAGQPAVSEALPPVGLLQNPNADPNIYLPANQVLAGQYDQNL
LQQGLVGQAILPASMSAAGDLTVSLPDGLTTLDGIQLQLTPANLVCPGVQISGIDPTNIN
NITLQIDHALFQQTLQQGGLLSQPLSVDTSLVSHSGSQLMSTTDPSVPANVVIHPLTSLA
LQPSSITPAQVSMAGLSEQDSANVCLSVGCAGSQDLSHVMSSSGLVAGGGSSGQEITLTI
NNSSLTQALAQVQAQASAAGSSSAAGNPQEITLTISVLGAVFHSLPSSTTPSHSAVSQSL
VMSSGGMAGDGSVTLTLADAQGMLDGVTLNLNTQSQTFPAVLNESGMSGQPVAPGQQVIL
VSQHSQSASGASGNVYSTSGHALKCGKDPQMNTDNRNQCYYCDQMFQNANALRRHCRQAH
GKDRCHVCSVCRKAFKRATHLKEHERVHQPGPSPSSQKPRLFNCSSCVKAFAKRSQLERH
NRTHTGERPFKCSQCDKAFNQKSALQVHMVKHTGKKPFKCEVCNIRFTQKSNMKHHMKRS
HGY
Download sequence
Identical sequences H2N2I6
ENSORLP00000025674 8090.ENSORLP00000025674 ENSORLP00000025674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]