SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025678 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025678
Domain Number 1 Region: 1010-1033,1078-1102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000594
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000025678
Domain Number - Region: 918-994
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00057
Family Homeodomain 0.021
Further Details:      
 
Domain Number - Region: 315-339,428-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00144
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025678   Gene: ENSORLG00000020732   Transcript: ENSORLT00000025679
Sequence length 1123
Comment pep:novel ultracontig:MEDAKA1:ultracontig182:2517518:2521299:-1 gene:ENSORLG00000020732 transcript:ENSORLT00000025679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRTTVRRFPAYMPEDELKAADHDEEEHLQDDGLSLDGQDAEFLCNEEEEDVDGGQPPSY
RDSPLSNGTNPDAGYGSPLSDASDRLADFKSPSYRDGQEREGAALPSPFRPSNGLSFQDS
LARMNAVYANLISEASWSSLTMDIMKSKSAAAGSGNGAPNSAEPVSTASASTTTTINKSS
ASSVSSHSASSSSGSSSGAASNGSGITYDWHQAALAKTLQQTPYHLLPEPSLFSTVQLYR
QNNKLYGSVFTGASKFRCKDCSAAYDTLVGLTVHMNETGHYRDDNKDKDEDQGKRWSKPR
KRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPALATKLVP
TSAKKRAIQDALASPCSPDSVHVGSGVGSIPLSDAGKDTKATANPYVTPNNRYGYQNGAS
YTWQFEARKAQILKCMECGSSHDTLQQLTAHMMVTGHFLKVTNSASKKGKQLVFDPVVEE
KIQSIPLPPTTTRLPVPSSVKSQPVSPALSSASEEKREGGDEEKVESCEPVDKKIKEEKD
DASEKSENDITSYKYLREEDLEEAPKEGLDILKSLENTVSSAISKAQTGAPTWGGYPSIH
AAYQLQGAMKSSATVLPPTVQSVQMQPMFNSGLRGLVSDPNSVIQSPHSPSSPTPLRSNV
TAMEELVEKVTGKGATVKKEKEEKVVSMERCRPPSLGKSPSPALREQLPSPNDLSVGKPS
GLRSSSPGSVDSDLICKKEPKESPVDGHNSHSKNGSDACQSPVTNGCNSLGIITDHSPES
PFVNPLSALQSIMNTHLGKASKPINPSADPLSMLYKISNSMMDKPAFNAIPQGKPAEPIN
HYQLYENNDQPIDLSKNGNKPLVSPPESVSSPLRENALMDISDMVKNLTGRLTPKSSTPS
SISEKSDADGSTFEDALEDLSPVQKRKGRQSNWNPQHLLILQAQFASSLRETPEGRYAMT
DLGPQERVHICKFTGLSMTTISHWLANVKYQLRRTGGTKFLKNMDSCQPVFLCSDCASQF
RTPSSYISHLESHLGFSLKDLSKLSAEHLREQQAASKVITDKMTFGSPLSALSTPEDDTG
SVYQCRLCNRTFVSKHAVKLHLSKTHGKSPEDHLVFVTALEKL
Download sequence
Identical sequences H2N2J0
ENSORLP00000025678 8090.ENSORLP00000025678 ENSORLP00000025678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]