SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025683 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025683
Domain Number 1 Region: 20-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 82-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 124-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000102
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025683   Gene: ENSORLG00000020738   Transcript: ENSORLT00000025684
Sequence length 206
Comment pep:novel ultracontig:MEDAKA1:ultracontig182:2752791:2774255:-1 gene:ENSORLG00000020738 transcript:ENSORLT00000025684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNRQGFYTRGKFECDLCDRSFSEKWALNNHMKLHSGEKPYKCAWPSCHYSFLNLSAMKDH
YRTHTGEKSYLCDLCGFAGGTKHALTKHRRQHTGERPFKCKLCNFASTTQSHLSRHKRVH
TGEKPYRCPWCDYRSNCAENIRKHILHTGKHDGVKMYNCPKCTYATNSPMEFRNHLKDSH
PDIENPDLAYLHAELHKQKQQKNTVK
Download sequence
Identical sequences H2N2J5
ENSORLP00000025683 8090.ENSORLP00000025683 ENSORLP00000025683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]