SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025686 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025686
Domain Number 1 Region: 119-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-18
Family Classic zinc finger, C2H2 0.00071
Further Details:      
 
Domain Number 2 Region: 83-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000196
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 3 Region: 456-504
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000428
Family Homeodomain 0.005
Further Details:      
 
Domain Number 4 Region: 646-704
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000107
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 5 Region: 546-592
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000133
Family Homeodomain 0.0044
Further Details:      
 
Domain Number 6 Region: 278-336
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000163
Family Homeodomain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025686   Gene: ENSORLG00000020740   Transcript: ENSORLT00000025687
Sequence length 828
Comment pep:novel ultracontig:MEDAKA1:ultracontig182:3107758:3136199:1 gene:ENSORLG00000020740 transcript:ENSORLT00000025687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRRKASTPCMVRPEQTMVELDDEEKESHHMDVQTTTEKHTEEGLISAPPSTDGESSMD
VDLNAKVSETNKSSDKPTAEPPKPPRKQQGGYECKYCTFSTQNLNTFKEHVDSNHPNVIL
NPLYLCAVCNFNTKKFDTLTEHNERRHPGESNFKFKRIKKNNQTILEQTIEGCSNTVIYN
AANKLVMAPQSKASTVKANNAKVTSSDDKQTEPRLGNATPDLAKKAITALNVNGTVIIPE
STLLKAGGLSHIMPSLQQPLNYTQVPKIAVPLNTTKYNPSLDDNLTLISSFNKFPYPTQA
ELSWLTAASKHPEEQIKVWFTTQRLKQGISWSPEEVEEARKKMFNGTISTGPQTLTVVAS
QISSRSSPAQPVHSTSLPCQLLGQSSLVLTPVANGSTVTCAPLALTVATQVAQSLKRPLA
CPVITTESKRPSIIQTVSASSRPASSKVLSFTVDPNKTAEQLSVLRSSYTQCPFPEEDEI
YRLIETTGLSRGEIKKWFSEQRLLNLKNIPTPPVLVKAEAAPLGKDVPVKKAVPHKFPLL
ERVKGKTSEQLKALEESFQRSCSPSEAELGQLAQETRLSKTEVDCWFSERRALRDNMEKV
LLTMASKNTEDRSERQGGALLNGTPHREHNGKPLHCSLSAASLSPTVISTDSLALLRETF
CRTQWPTPEEYSQLEAQTSLGRTDIVRWFKEHRSALKNGEILDWMEGFQQAGTQPAKQNG
QSSEKQLSAPVEGGVGKEEEADGKEAQTESSRLFQQDKLQWLTDRLAEGVAGLSRAGQDH
TGTSPENKDKWVKVTVAVGEETAGGVEQQKPATVTEAVALEQPGQVTG
Download sequence
Identical sequences H2N2J8
ENSORLP00000025686 ENSORLP00000025686 8090.ENSORLP00000025686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]