SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025697 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000025697
Domain Number - Region: 24-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00491
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 49-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0777
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025697   Gene: ENSORLG00000020749   Transcript: ENSORLT00000025698
Sequence length 115
Comment pep:novel ultracontig:MEDAKA1:ultracontig182:3298190:3300837:1 gene:ENSORLG00000020749 transcript:ENSORLT00000025698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRGSQILQNILSSSPSTDQMNAGHFCFSCEQIFGSRKVLEEHVCSSASFICSCGTEFK
EYNAMKQHSSTHEPGHQVLDHETIKKRRIEKVLEEQEKIKKLQQAEILKTSNVRR
Download sequence
Identical sequences H2N2K9
ENSORLP00000025697 8090.ENSORLP00000025697 ENSORLP00000025697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]