SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025734 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025734
Domain Number 1 Region: 137-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 53-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-23
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 179-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 15-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000182
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 100-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000122
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025734   Gene: ENSORLG00000020778   Transcript: ENSORLT00000025735
Sequence length 241
Comment pep:novel ultracontig:MEDAKA1:ultracontig251:61030:62043:1 gene:ENSORLG00000020778 transcript:ENSORLT00000025735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITNLSDYMETRSDERCYICKECGKSFCNKSLFRIHARIHAEDKRFSCKECKKSFSHVSNL
KRHMRTHTGEMPFSCKECKKSFRHVYNLKRHMRTHTGEKPFSCKECEKSFSRLFHLKRHM
ITHTGEKLFSCKECKKSFRDASHLKTHMRTHTGEKPFSCKECKKNFSRISVLKQHMRTHT
GEKPFLCKECKKSFNQISTLKTHMRTHTGEKPFSCKECKKSFSHVCNLNKHMTTYNNEFS
K
Download sequence
Identical sequences H2N2P5
8090.ENSORLP00000025734 ENSORLP00000025734 ENSORLP00000025734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]