SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000242 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000242
Domain Number 1 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 99-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000242   Gene: ENSORLG00000000202   Transcript: ENSORLT00000000242
Sequence length 396
Comment pep:novel chromosome:MEDAKA1:2:7451424:7455998:1 gene:ENSORLG00000000202 transcript:ENSORLT00000000242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPIKEEQEELLISPDEDQLDLKQETDTLMEIPTYEEDENSEADLNNQQSFNVTDSQEKE
GNQHEESTSTTDEETDPQNRDQRKRRDRSHVQKCGCDKSFSYIFNLQTHMRTHTGEKPFS
CKECDKSFSHRSTLLNHTRTHTGDKPFSCKECDKSFSCITNLQTHRRTHTGEKPFSCKEC
DMRFNQMSNLKKHTRTHTGEKPFSCKECEKSFRYISNLQTHMRTHTGEKPFSCKECEKSF
NQLSHLKAHMRTHTGEKPFACKECEIRFTTLSDLKRHMRTHTGEKPFSCKECNRSFSRMS
SLHTHMRTHTGEKPFSCEECDRSFSQTSSLKAHMRTHTGEKPFSCEECDSSFCHRSSLQI
HARTHADGLWCNQLTKSNPEKTQKESRFRCHLCLNS
Download sequence
Identical sequences H2L3C4
8090.ENSORLP00000000242 ENSORLP00000000242 ENSORLP00000000242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]