SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000374 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000374
Domain Number 1 Region: 19-153,183-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-73
Family Calponin-homology domain, CH-domain 0.0000321
Further Details:      
 
Domain Number 2 Region: 548-686
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000694
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 867-1002
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000162
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 1064-1215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000396
Family Spectrin repeat 0.017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000374
Domain Number - Region: 692-767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00671
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 350-490
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0137
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 1186-1290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0341
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000374   Gene: ENSORLG00000000306   Transcript: ENSORLT00000000374
Sequence length 1432
Comment pep:novel chromosome:MEDAKA1:2:14346432:14362221:-1 gene:ENSORLG00000000306 transcript:ENSORLT00000000374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPSCVSSRGHGRFDRLLEQNQNEQEAVQKRTFTKWINSHLEKHKLRLEMNDLFEDIKDG
VKLLALLEVLSGQRLPCEQGRHLKRIHWVSNISTALKFLEGRKSGLPGPPIKLVNIHATD
VADGRPSIVLGLIWTIILYFQIEELTSNLPALQAFSNSSSSVDSLTSSETGSPPVKRKVL
HKFQGNAKKVLLRWVQCTAAKHHGIEVKDFGPSWRDGVAFQSMVHAIRPDLVDMEEVRRR
SNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPNPGPAAGQQE
REERKMLRELKVFLDQLEKDVLRAQGSDGNLSDKYQVFKHFHVQFEMKKKQAEPLLQPVH
PDGKLSVDQALVKQAWDHVSARLLDWHIHLDKSLPGPLGSIGAWLHRAEMALREDFPLHH
APEETANVLHRKLQQHQDVLKNLEVHRRTFQQIHKDRSVHGVPVPPEQLQDMAERFNFVS
AHSHSHLIQLEFWEMKYRLTAFLLLAESKLKSWIIKYGRRDSVELLLRSYLTFTEGQRFF
EQYEVLFTALQRAAEVYVKSDSAADEAEGVSKFLADATVQWKNLALEVRSVRSMLEEVIC
NWEKYGSTVAALQAWLEDAEQVLGQSENIKRDFFRNLSHWIQQHMDMNDAGNFLIETCDE
TVSRDLKQQLLLLNGRWRELFIKVKHYGRADEVDKLRQDYQDAMNTLKLFLDATDVKMTA
PVQVSFLNVRAFVQDVEEIKQKVPAMEAACRAAGRTAQLLSKDAPQEELLQMTAVMASIK
EQLSKIREGCLPLLREAQALLPPLEEMEKNITGFYQALEKASCIHGLLQPGPPPLTGFSF
LLQELATLTHSCKKCLTVIERTHQNIQRSLSSSGALQHLDLALLQKRVAELQTASQNMIR
ESTEWRRQEETNSSLLRRFEESRVELEKVLKAAQSCVTESGEPEDLLRKHTDFFEQLDQR
VLNTFLKACDELTDILPEQEQQALQETVRKLHKRWKDMQTDAPLHLLHVQVEAERSRLEL
SMQECKAELTRENRHLVGVGSERLLKEHRSFFGEKGPLSQCEKRLQLMEELCQKLPEEDP
AHRSLQSARKELGELQEEIQSTRLKLLQHQDKWKDYNKRYAELSCWLISKESQLRLLRNR
ASDHRKYGQVKTAIAELRNEAELQEGNLGWLNARMADLIEVSADDDAQRQGAALTKLSAD
LKGLVASLSEAEKMLLTVGDCVQFREEVQATLEDLAQGQKEVQAEASQILDSSDPREAQQ
LLLVHQQHLKRLRMKRKEVQQLFSRGQQLQVEEALEGALQQDLQTLENSLSRMEQSTDSQ
EQSLEVTLAAWQQHSDQQEAVQTFVLRARSSMDRELNFSSPESLEVELDQARVLLKQSEG
EALHTKTLSKRAAEIQLSPKNKTLLLQQAHSLREQVEEVEESLKQDGLTRHV
Download sequence
Identical sequences H2L3P8
ENSORLP00000000374 ENSORLP00000000374 8090.ENSORLP00000000374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]