SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000466 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000466
Domain Number 1 Region: 222-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 278-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 138-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-24
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 82-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 43-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 334-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 389-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000061
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 184-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000766
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000466   Gene: ENSORLG00000000380   Transcript: ENSORLT00000000466
Sequence length 435
Comment pep:novel chromosome:MEDAKA1:2:14806673:14808508:-1 gene:ENSORLG00000000380 transcript:ENSORLT00000000466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNVPEPSPIKVEPEELFISQDKEKKHSPFKSGESLGSISRKDKRFSCKECDKSFSHRSNL
KRHIRTHTGEKPFSCKECEKRFSYVSSLKTHMRTHTGEKPITCKECDKSFTCISSIKTHM
RTHTGEKPFSCKECEKRFSRISHLTSHMRMHTGEKPFSCKECDKSFSDISSLKRHIRTHT
GEKPFSCKECEKRFSDVSSLKTHIRSHTGEKPFSCKECEKGFSDVSSLKTHMRTHTGEKP
FSCKECDKSFSRVSSLKTHMRTHTGEKPFSCKECEKGFTDISSLKRHMRTHTGEKPFSCK
ECDTRFSHRSSLKTHMRTHTGEKPFSCKECDKRFSRVSSIKTHMRTHTGKKPFCKECDKG
FNQISSFKTHMRTHTGKKPFFFKECDKGFNQISSFKTHMRTHTGEKSFSCLKCDKSFSDV
CSLKRHMRTNTGEKP
Download sequence
Identical sequences H2L3Y6
ENSORLP00000000466 8090.ENSORLP00000000466 ENSORLP00000000466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]