SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000628 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000628
Domain Number 1 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 134-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 95-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 347-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000234
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000628   Gene: ENSORLG00000000513   Transcript: ENSORLT00000000628
Sequence length 403
Comment pep:novel chromosome:MEDAKA1:2:15681835:15683406:1 gene:ENSORLG00000000513 transcript:ENSORLT00000000628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLHIKEEQEEPEPPQIKIEQGEPDPPQIKIEQGEPDPPQIKEEAKEQEPSQMKLEQEEHE
APQIKQEQEELCISWEEEKRQTSSPKCGQLSHVRKLYFCPECGKSFGNWSQFRVHMRTHT
GEKPFCCKECDKRFSDAYDLKIHMRTHTGEKPYSCNKCNFSCSRSSNLKSHMRTHTGEKP
FTCKECDKSFTQMYSLTPHMRTHTGERPFSCKECDKSFRHKSVLKRHMRTHTGEKPFFCK
ECDTAFSRLFHLKIHMRTHTGEKPFSCTECGTTFSRASSLKTHMRTHTGEKPFSCTECGT
TFSRASSLKTHMRTHTGEKPFSCTECEKGFSCVSHLKTHMRTHTGEKPFPCTECCTSFSR
VSSLKSHLRTHTRDKPFPCTKCVTSFSRVSYLKTHMRTHTEDK
Download sequence
Identical sequences H2L4D7
ENSORLP00000000628 8090.ENSORLP00000000628 ENSORLP00000000628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]