SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000706 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000706
Domain Number 1 Region: 427-529
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00081
Further Details:      
 
Domain Number 2 Region: 116-222
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00066
Further Details:      
 
Domain Number 3 Region: 325-426
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 4 Region: 531-576
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0063
Further Details:      
 
Domain Number 5 Region: 9-71
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0081
Further Details:      
 
Domain Number 6 Region: 219-327
Classification Level Classification E-value
Superfamily SRCR-like 0.00000114
Family Scavenger receptor cysteine-rich (SRCR) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000706   Gene: ENSORLG00000000575   Transcript: ENSORLT00000000706
Sequence length 576
Comment pep:novel chromosome:MEDAKA1:13:1423882:1441431:-1 gene:ENSORLG00000000575 transcript:ENSORLT00000000706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHPGKSMEYSVRLENRSSRCSGRLEVKSNNWWSSVCEDDFDLLDTEVVCRELGCGAPSVL
QGALYGEAEAPRTLGFEPFGRLECFPLHHHATPIDSCRFQCGHVTCCSEFISVSLCDFKL
EDGSSRCSGRLEVKSNNWWSSVCEDDFDLLDAEVVCRELGCGAPSVLQGALYGEAEAPIL
SREFLCEGHESVLLDCGSSWRKTKACPPDKAVGLTCSDPDTVRLMGSSRCSGELHVKSGE
EWRAFDARAFPATQTTLASVCKKLKCGSYISWTVKILPTEKPVFHIHYTCSYEFQLNLEE
CVYDDTETIETLEITCSGNKPSDSDCMLENGSSRCSGRLEVKSNNSWSSVCEDDFDLLDA
EVVCRELGCGAPSVLQGALYGEAEAPFLTREFLCEGHESVLLDCGSSWRKTKACPPDKAV
GLTCSDSVRLENGSSRCSGRLEVKSNNSWSSVCEDDFDLLDAEVVCRELGCGAPSVLQGA
LYGEAEAPILSREFLCEGHESVLLDCGSSWRKTKACPPDKAVGLTCSGSTDSVRLENGSS
LCSGRLEVKSNNWWSSVCEDDFDLLDAEVVCRELGC
Download sequence
Identical sequences H2L4L1
8090.ENSORLP00000000706 ENSORLP00000000706 ENSORLP00000000706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]