SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001411 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001411
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.43e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 89-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001411   Gene: ENSORLG00000001146   Transcript: ENSORLT00000001412
Sequence length 408
Comment pep:novel chromosome:MEDAKA1:8:2132611:2142406:-1 gene:ENSORLG00000001146 transcript:ENSORLT00000001412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIDLKQETDTLMEIPTYEEDENSEADLNNQQRNFRVEHEEPEPSQTEEEQDEETDPQNRD
QRKRRDRSHVQTGSDERYCASKKCGNSASETHMRTHTGEKPFSCKECDASFSRRSSLETH
MRTHTGEKPFTCKECDKSFSQLSHLKSHMRTHTGEKPFSCKECDASFSHKYSLETHMRTH
TGEKPFSCKECKKSFNQISHLKLHMRTHTGEKPFTCKECNKSFSEKSKLKIHMRTHTGEK
PFSCKECKKSFSQISHLKTHMRTHKGEKPFSCKECKKSFSQLSHLKSHMRTHTGEKPFTC
KECDKSFSQLSHLKSHMRTHTGEKPFSCKECEASFSHKYSLETHMRTHTGEKPFSCKECK
KSFNQSSSLKLHMRTHTGEKPFTCKECDASFSHRSSLKTHMRTHTGEK
Download sequence
Identical sequences H2L6G2
ENSORLP00000001411 ENSORLP00000001411 8090.ENSORLP00000001411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]