SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001785 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001785
Domain Number 1 Region: 147-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-99
Family Protein kinases, catalytic subunit 0.0000000001
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-22
Family Pleckstrin-homology domain (PH domain) 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001785   Gene: ENSORLG00000001445   Transcript: ENSORLT00000001786
Sequence length 482
Comment pep:novel chromosome:MEDAKA1:1:3277165:3291351:1 gene:ENSORLG00000001445 transcript:ENSORLT00000001786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKKNKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMK
ILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHL
SRERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TDTATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFEL
ILMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSTIDWQDVYDKK
LVPPFQPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASG
RE
Download sequence
Identical sequences H2L7H3
ENSORLP00000001785 ENSORLP00000001785 8090.ENSORLP00000001785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]