SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002006 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002006
Domain Number 1 Region: 172-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 746-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 116-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 5 Region: 3-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-17
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 788-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 570-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000582
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 704-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000012
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 213-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 466-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000706
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 11 Region: 526-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000755
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 626-650,677-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000685
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 13 Region: 425-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000166
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002006   Gene: ENSORLG00000001615   Transcript: ENSORLT00000002007
Sequence length 841
Comment pep:novel chromosome:MEDAKA1:13:3369122:3374556:-1 gene:ENSORLG00000001615 transcript:ENSORLT00000002007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESFKYAHSLTVHKRKHTGDSPFTCDQCNRSYRTGTALKRHKMIHTGEKPFTCHVCGARF
SLNNNLKRHLRIHTGEKPFTCQDCGKSFSDNNKLKSHMLIHGARKPFICKICLKGFSAAS
SLKLHERGHSEQKEFNCSLCGKAFHNKYSFSYHQRSHSGEKPFVCDKCGKRFFQAASLKQ
HERIHTGEKPYKCDQCGKAFRTDGNFYRHMRIHTGEKPFECGYCQKKFHQSNQLKSHLQV
HTGQKLYSCQQCGHGFSDSKIKFILDTLVEAAVDVLGVSGRQTGNAKMEDRLPAVTVPAT
HGDSVPCLWNKFVKLNPTESRGFLLLDFIEHATKMSSLLLSENSALKAQLERLEAELQSA
TRNVEDARRWRESVLSGCPVLFQQSGLLFRLKPFGRLMRRTDAQQEDGEDEESSSAAQVG
RDDAKHTDTHGELRPFACDQCPRTFRTSVTFQNHLLRHQEKIQASFSCQLCSKTFKSRTG
LKRHQLVHTDARPFVCYVCQKAFKTKHNLHTHESVHAAEKPGGKTFGDAATLQSHHSVHA
NEQPHVCAACGKAFTRRRSLRAHQAVHRGKTFTCEVCGVGFTFQHNLRRHMRLHTGEKPC
TCKVCGRSFMHDNKLKAHMLLHGERKAFMCDLCGKTFLYNCQLRKHQRTHEEKRVTGRRS
QVRGSRRVIYRQDKTTTDMTPFSCTTCRRSFDSTGSLRRHELIHSKNPQYTCDKCGKSFH
YKATYQYHQRVHSGERPFACDVCRKTFIIRKALTSHMLQHSGEKPHRCQHCDKTFRIYTN
LLRHQRVHTGEKPYECEVCGTRFRQLGHVKFHMQLHTGEKPHSCSSCRRSFSESRLLKRH
K
Download sequence
Identical sequences H2L837
8090.ENSORLP00000002006 ENSORLP00000002006 ENSORLP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]