SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002269 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002269
Domain Number 1 Region: 375-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-45
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-18
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 148-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000336
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002269   Gene: ENSORLG00000001822   Transcript: ENSORLT00000002270
Sequence length 531
Comment pep:novel chromosome:MEDAKA1:1:4238924:4246625:1 gene:ENSORLG00000001822 transcript:ENSORLT00000002270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADFPLCALEEELTCCICLSPFDCPVTIPCGHNFCQDCLLATWEDANFSCPQCRTSFPSRP
ELQKNTVLSSVVEAFKLKSSKNSSAIPTEQESKAEEQESKAEEKHVVLCDACMEAEASRT
CLTCMASYCEEHLRPHRDNPIFRVHKLSEPVGNLMEHICSDHHKLMELYCTNHDRLICSS
CLQQAHKGCSFTSPEEQRSLKEVAVPVHSIRLLQLCGKYDIVPAEQQEFIKKLRAGGADS
EDSWDSATSRKKTIAAEYQQVRDMLTREESEASNALDREVESGQMKIRTLMKKFSENVEN
MNLQNKQKLFILFSITTLKTCKFTRNNTKVVCLWEPSLKLRSAKKKGTELKKKVRANKKK
SLSTVEVSQLQQLGVGFTFDPRTAHKRIILTEDFTKASVSDEPTNYPECPERFALCSQVL
SSRGFIRGRHYWEFRLSCNNFIGVGLAYGSLDRKGPASRLGRNNMSWCLEWFNVKLSAWH
SSVEVVLVNPSPKRVGVLLDCEEGRATFYNVADRAYPLHSFSIPCVEAVYP
Download sequence
Identical sequences H2L8T7
8090.ENSORLP00000002269 ENSORLP00000002269 ENSORLP00000002269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]