SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002271 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002271
Domain Number 1 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-23
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 145-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-17
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 104-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000128
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002271   Gene: ENSORLG00000001825   Transcript: ENSORLT00000002272
Sequence length 341
Comment pep:novel chromosome:MEDAKA1:2:18491605:18492906:1 gene:ENSORLG00000001825 transcript:ENSORLT00000002272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEPDLVKIKEQEEHKPSNIKEELKEPEPPPIEKEQGKPETPQIKEEPMEPEPPQIKEEEE
GFCISQDEDQFDLKEETDTLMEIPTYEENEHRKCEQSSEENRLSFEKNHTRDISDKDLYV
CEECGESFRWWTHLKTHMRTHSGELFSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECD
KGFGQISHLKRHMRTHTGEKPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFS
RVSGLKIHMRTHTGEKPFSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLST
LKNHIRTHTGEKPFSCNECDSSFSQKSNLKTHMRTHTGEKP
Download sequence
Identical sequences H2L8T9
8090.ENSORLP00000002271 ENSORLP00000002271 ENSORLP00000002271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]