SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002314 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002314
Domain Number 1 Region: 673-865
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-72
Family Sec7 domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 82-154,429-612,1121-1507,1706-1808
Classification Level Classification E-value
Superfamily ARM repeat 8e-26
Family MIF4G domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002314   Gene: ENSORLG00000001855   Transcript: ENSORLT00000002315
Sequence length 1830
Comment pep:novel chromosome:MEDAKA1:7:4323911:4356742:-1 gene:ENSORLG00000001855 transcript:ENSORLT00000002315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANNKTKSMFLSRALEKILADKEVKRSQHSQLRKACQVALDEIKEELEKQNPARDSLSGDG
TVVPPKANYIEADKYVLPFELACQSKCPRIVSTSLDCLQKLIAYGHITGNAPDSRSPGKR
LIDRLVETICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTVLLTVRTCYNIYLAS
RNLINQTTAKATLTQMLNVIFTRMENQAVSLTHCLHLLVTHHRPDSTASRSTPPPAAPEL
IQNQTADPPPVNEGPERGVAPMNGEEQVTPSKGVSRCPARVSLRSLKLTLFMFPSDSVFE
DDGVETPPTATQQTEEEEEQRGGDMNAADQEEESWSNLRGTGEEAPAPTPPEPAEVPPPT
FRTEGQQMNGFIEDRSSVSSTDMLDAEALQGPHSSARFSHILQKDAFLVFRSLCKLSMKP
LADGPPDPRSHELRSKIVSLQLLLSVLQGAGPVFRTHEMFVNAIKQYLCVALSKNGVSSV
PEVFELSLAIFLTLLSHFKVHLKMQIEVFFREIFLTILETSTSSFEHKWMVIQTLTRICA
DAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPLQELSLRKKGLECLV
SILKCMVEWSKDMYVNPNLQTNLGQEHPSDSEGAELKLPEQLAGRRDSISSLDSTVSSIP
MSQADHPEQYEVIKQQKDIIEHGIDLFNKKPKRGIQYLQDQGMLGTTAQDVAQFLQQEDR
LDTTQVGEFLGENNKFNIEVMYSYVDQLDFCGRDFVSALRAFLEGFRLPGEAQKIDRLME
KFAARYLECNQGKDWSASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDS
KDLPEEYLSSIYDEIAGKKIAMKESKEYSITPKSTKPNVASEKQRRLLYNVEMEQMAKTA
KALMEAVSHAQAPFFSAKHLEHVRPMFKLAWTPLLAAFSVGLQDCDDPEVASLCLEGIRC
AIRIACIFSMQLERDAYVQALARFTLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGN
SWHEILRCISQLELAQLIGTGVKTRYISGVVRDRDSSIRGLPAGTEEFMPLGLGNLVGSQ
DKKQMAHIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASAHQP
RMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKF
LEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCVAQMVNSQAANIRSGWKNIFSV
FHQAASSHDESIVELAFQTTGHIVMNTFREHFAAAIDSFQDAVKCLSEFVCNAAFPDTSM
EAIRLIRHCAKYVAERPQALREYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVR
TRGLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIFDNMKLPEQQTEKTEWMTTTCNHALYA
ICDVFTQFYEPLSEILLADIFTQLQWCVRQDNEQLARSGTNCLENLVILNGEKFSPEVWN
VTCSCMLEIFQNTCPHALLTWRPAGQDEEAADSKHFVRKAARRLNGLRHTDARARLWKPR
DVDFDSQSQSSFDRALSERGHSQMSSDDTWKDQRLFAGLLIKCVVQLELIQTIDNIVFYP
ATSKKEDADNMAAAQRDALDEPEAGRGEAAADQGMYRLMTSAHLFKLLDCLLESHNFAKD
FNSNNEQRTALWRAGFKGKSKPNLLKQETSSLACSLRILYRMYSDPQLQDSWPDIQTRLL
LVCSEALGYFISLTSESHREAWNSLLMLLLTRTLRLPDDKFKPHASCYYHHLCEMMQFDL
IPELRAVLRRFFLRIGSVFHIAAPEGRRAQ
Download sequence
Identical sequences H2L8Y1
ENSORLP00000002314 ENSORLP00000002314 8090.ENSORLP00000002314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]