SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002726 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002726
Domain Number 1 Region: 162-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000952
Family HkH motif-containing C2H2 finger 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002726   Gene: ENSORLG00000002197   Transcript: ENSORLT00000002727
Sequence length 207
Comment pep:known chromosome:MEDAKA1:1:6189810:6191095:1 gene:ENSORLG00000002197 transcript:ENSORLT00000002727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQPEPGTPSQPEPGTPSQPEPGTPSQPEPGTPSQPEPDASVPPPLDSAPEVELPPEASAD
SSSQSVNEDAVTAERKEENESAHPLESQAEKEVDVLDSKEEQECTSEEEKNGAEGQSEST
EAVKPQNTDDHVTKETTTTAELPLPPYDPHQPVGMEYLIPKTGFFCKACSRFFTGDKAME
ISHCKTRKHYESLQKFLQTKASSVKTD
Download sequence
Identical sequences H2LA22
ENSORLP00000002726 ENSORLP00000002726 8090.ENSORLP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]