SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002740 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002740
Domain Number 1 Region: 365-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-61
Family SPRY domain 0.00000562
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-21
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 3 Region: 149-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.00092
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002740
Domain Number - Region: 126-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000124
Family B-box zinc-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002740   Gene: ENSORLG00000002209   Transcript: ENSORLT00000002741
Sequence length 544
Comment pep:novel chromosome:MEDAKA1:1:6195741:6208994:1 gene:ENSORLG00000002209 transcript:ENSORLT00000002741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNIHGLSEDQFTCSICLDLFDNPVSTPCGHSYCQSCISSYWDGKGGGAGGGRAARPYH
CPLCKESFRRRPELHINRTLKEITEQFKQMAIQGEGVGQMEPPAPPQTPPVEPGTGLKVK
DVFVCDNICICSLCVEAAGHRGHSVVPAMREWQMKKCPIHLRGLELFCRTDNICICSLCV
EAAGHRGHSVVPAMREWQMKKTQMGIVETELRGLIAERERKVEEIQTSIREIEVAAERET
EGTVFAFAQLISIVERCQSEVMEVIEMTLRSAQLRAQGLLTELKEDIDMLKKKSLAMNRM
MDSEDYVFFLKSFSALATPATPKTWTNVSMSSPLTSGVILKDINLMMNRLQEEIRKLPED
ELVKVQHHTIDMTFDPDTAYPGLILSDDGKQVRCCDSRRNLPENPKRFTECAFVLGKQGF
SSGRFYFEVQVKGKTKWSIGVAKESVSRKGDIKLCPQNGFWALWMRSRGEYRALAGPSVS
VHLRSAFEKVGVFVDYEAGLVSFYDVNNAAHIYSFTGCHFTERLFPFFDPSRNNDGQNDA
PLII
Download sequence
Identical sequences H2LA36
8090.ENSORLP00000002740 ENSORLP00000002740 ENSORLP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]