SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002859 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002859
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 29-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 420-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000615
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000187
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 75-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000627
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002859   Gene: ENSORLG00000002307   Transcript: ENSORLT00000002860
Sequence length 510
Comment pep:novel chromosome:MEDAKA1:4:5659912:5674496:-1 gene:ENSORLG00000002307 transcript:ENSORLT00000002860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRYYCPECGRSYPLKCRLKTHMRTHTGEQFTCGECGKSFTRPDVLTVHMRIHTGAKPYTC
KTCGEAFGRRDKLNIHRRIHTGEKPFLCQECGKNCVDRYYLNKHMETHTKTVSLSGSQPY
SDSKKSKKSFTQKSQKLPDGDRFPCEVCGKSFRTAAILVAHMRIHTGEKPFSCNVCGKRF
TACGTLANHMIIHVNKRPFSCLLCDKSFKQRRHLNVHMRVHSGEKPYSCEECGLSYKSNS
ALKSHKRVHAADDDLEGTDQGADATGCPTACEKPFNKETQKQDKSYTCEQCGKSFSQDLG
LMRHMRLHTDERPFVCKVCGKTFKQSVSLKNHTRIHTGEKPFSCKVCGRSFTLGSTLIRH
MKVHTGERPFLCKVCGKTFVKRDHLQGHTRIHTGETPFSCQVCGKSFKLSVNLKSHLRIH
TGERPFSCEVCGRRFVQNSQLKVHMRMHVTSPNEPLACEECGQTFSQIRKLKRHMAAHSR
HKSIACEECGETFGSTLTFNDHMKIHTSEE
Download sequence
Identical sequences H2LAF1
ENSORLP00000002859 8090.ENSORLP00000002859 ENSORLP00000002859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]