SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002899 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002899
Domain Number 1 Region: 46-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000311
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 184-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000672
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 91-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000347
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000478
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002899   Gene: ENSORLG00000002338   Transcript: ENSORLT00000002900
Sequence length 560
Comment pep:novel chromosome:MEDAKA1:7:4980493:4987296:1 gene:ENSORLG00000002338 transcript:ENSORLT00000002900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAADASHHITALTPEEEGRRAAAKLFGSAAPLPHECLVCGALFTSQEKLRLHGLSHT
GEKPFHCSQPHCPKAFSSKYKLFRHMATHSPQKTHQCSFCEKMFHRKDHLKNHLQTHDPN
KEAFKCDECGKHYNTKLGYKRHVAMHSATAGDLTCKVCMQSYESTPVLLEHLKSHSGKSS
GGAKEKKHPCDHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHS
QELLKIKTEPPDMLGLLASGSPPCSVKEELSPMMCGMGPNKDPMMGKSFPSGASFPMSMY
NPHHLQAMSNPGVGHPHPSLMPNSLSAAMGMGCPMESPASIHPHSPPLPPHHQPAAPQQQ
HQPQPAPKYQLGSTSYLLDKPLKVEMESFLMDLQSGLPGPVPSAEPHAAASPPKDGLEPT
SGLADELCGDPLLSKSPAVIAESLCAANMDFSHLLGFLPLNLPPYSAPMSTGGLVMGYTS
SATSSTSSSSSLHAAEPQAAAVASAAAAVSAAPLTSLQPQPQEQQSSGGGLGLGHLHPLP
PVFSSSLSTTTLPRFHQAFQ
Download sequence
Identical sequences H2LAI9
8090.ENSORLP00000002899 ENSORLP00000002899 ENSORLP00000002899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]