SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003320 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003320
Domain Number 1 Region: 369-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-20
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 139-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.78e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003320
Domain Number - Region: 193-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0157
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003320   Gene: ENSORLG00000002665   Transcript: ENSORLT00000003321
Sequence length 501
Comment pep:novel chromosome:MEDAKA1:18:2252728:2254254:-1 gene:ENSORLG00000002665 transcript:ENSORLT00000003321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRGLLLDQENLSCSICLDVLKEPVTVPCGHSYCMDCIKTHWDEDDQRGNHSCPQCRKT
FFLRPVLEKNIMLAELVEELKKTELRSDLCYAGPEDVSCDVCSGRKMKAVKSCLDCLASY
CEEHLQPHSVAPALQKHKLVDPSRNLQQNICSLHDEVMKIYCRTDQQNICYLCLMDEHKG
HETVSAATERMEKQKKLQETRQQIQQKIQDCAQAVKELQQEVEDINTAADKSVEDSEEIF
SEMIRLLQNRSSEVKQQIRSQQDDEVNRVLDLQEKLEQEIRDLKSKDREMEQLSHTEDHS
QCLHRYPSLSALSESTHSSSFHLSPLRYFEEVTAAVADTRDKLQELLRDSWTNITLTVDV
LPPKPEPKTRDVTLDPNTANVHLSLSEGNRKAEVMKQKLYYSRHPDRFTVCPQVLSRERL
TGRCYWEVEWGGQALYVTVAYKDTPRSGDCLFGWNDRSWALYYGINVYQFCCNKVLTPLS
GPSSTRVGVYLDHGAGVLAFY
Download sequence
Identical sequences H2LBP4
8090.ENSORLP00000003320 ENSORLP00000003320 ENSORLP00000003320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]