SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003893 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003893
Domain Number 1 Region: 455-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 371-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 331-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000116
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 278-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000221
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 417-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000622
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003893   Gene: ENSORLG00000003126   Transcript: ENSORLT00000003894
Sequence length 653
Comment pep:novel chromosome:MEDAKA1:8:5478515:5486332:-1 gene:ENSORLG00000003126 transcript:ENSORLT00000003894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMKSCQSLKEEVSVPSLGGMSQEEGHRAPVSQTYFHASNQDLELTEKVYKREVGGKPYS
VLVDAKMAARGSIGDHSLGQLSSQHVPPQHQQYFREGGVGQEAGAQGSHTGNETSTDDTD
NDDEDDVDEEGYKREQIIVEVNLNNQTLHVSKGDNKTGTSADDSERPGTDEDDEGEEEED
DEEDEDSPVEQEEEEDDDEEELGSPIIRSKRTRRGAGSLSATNQPRRKSLRTALSAASAG
MTTRGRRKHIESPKSKRRSARAASSPAGKSEMEEKEMLACEKCPRVFNTRWYLEKHMNVT
HRRMQICDKCGKKFVLESELALHQQTDCEKNIQCVSCNKSFKKLWSLHEHIKIVHGYAEK
KFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRC
ENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPFICEICG
KSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVTSPVVLQTSGPPV
PVRIFTNAFSSSSSTSGPGPSAVTPATTSASLGLSPSGGSISPPGPVGHTFSHHLASTPQ
PAHHHLAVPPVSHLPPPPALFKSEPLNHCGHEDSSYLHHMNPHDKGPGAPQHH
Download sequence
Identical sequences H2LD94
ENSORLP00000003893 8090.ENSORLP00000003893 ENSORLP00000003893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]