SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003900 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003900
Domain Number 1 Region: 466-620
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-48
Family SPRY domain 0.00045
Further Details:      
 
Domain Number 2 Region: 12-80
Classification Level Classification E-value
Superfamily RING/U-box 1.63e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-16
Family B-box zinc-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003900   Gene: ENSORLG00000003133   Transcript: ENSORLT00000003901
Sequence length 620
Comment pep:novel chromosome:MEDAKA1:18:2868228:2873541:1 gene:ENSORLG00000003133 transcript:ENSORLT00000003901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKENMMASVKISCSVCLDLLKEPVTVPCGHSYCMSCIETYWDGDDQRGNHSCPQCRKTFF
PRPVLEKNIMLAELVEELKRIELRSDLCYAGPEDVSCDGCSGMKMKAAKSCLDCLASYCE
EHLQPHSVAPALQKHKLVDPSRNLQQNICSIHDEVMKIYCRTDQQNICYLCLMDEHNGHE
TVSAATERTDKEKKLQETRQQIQQKIKYREKDMRLFQQEVEDINTAADKAVENSEKIFSE
MIRLLQKRNSEVKQQIRSQQEDEVSRVLDLQEKLEQEIRDLKSKDREMEQLSHTEDHSQC
LQRYPSLSALTIKDAYHSVSRAALGLSDHCLVYLIPTYRQKLKSAKPIVKTVKRWSDESK
FGKACRPSPTTGDHPPAPQTVTTWLRSLTTSTQGSWGPPSHRTLSGLITLTWSGKRLSRG
CSSCENPPPVRAALQDNVHLNHSPQRQLLPPSCHSDEILTPDHSEVRLDPNTAHRHLVLS
EENRNVSEMSDDQSYPDHPDRFTYWPQVLSTESLTGRCYWEVEWNEGELWVAVAYKNISR
TGHSTDSMFGFNDKSWSLHCASYGRYTFSHGNIRTRLLSPSSTRMGVYLDHGAGVLAFYS
VSETMTLLHRIQTTFTQPLH
Download sequence
Identical sequences H2LDA0
8090.ENSORLP00000003900 ENSORLP00000003900 ENSORLP00000003900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]