SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004737 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004737
Domain Number 1 Region: 276-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.17e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000103
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000566
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000397
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 352-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000743
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004737   Gene: ENSORLG00000003805   Transcript: ENSORLT00000004738
Sequence length 608
Comment pep:novel chromosome:MEDAKA1:9:6966398:6970053:-1 gene:ENSORLG00000003805 transcript:ENSORLT00000004738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRQAVSQHSFYLNTSPLYFKPPRFPPPSYHSVSLTGEPYSAFSPPAFYPMFGSGYTQKE
EPQKRKITSPTVDSQEHESSDKEAEEAEDSSKRKTVGLPHMGVTLAPHLMSSTPSKPIPG
MIDLSRLQLHHRLPGVNVPVQVKQEPLSPSLAWHPSPLLLRPPYYSALSHNLLPYPYFMP
GPFMHLPSAAFYAKEELRSNQVTGERAPRNEMSSTEKLGLSVHVDDSYYVDVGGDQKRWK
CRMCEKSYTSKYNLVTHILGHNGIKPHGCHLCGKLFKQLSHLHTHLLTHQGMRPHKCQVC
HKAFTQTSHLKRHMMQHSDVKPYSCSVCGRGFAYPSELRAHELKHEKGQENVCVECGLDF
PTLAQLKRHLTVHRGPTLYRCTECQKTFQYPSQLQNHMMKHKDIRPYICSECGMEFIQSH
HLKQHTLTHKGVKEHKCRICGREFTLLANMKRHVLIHTNIRAYQCHMCFKSFVQKQTLKA
HMIVHSDIKPYKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSKFTLKGNLTRHMKV
KHGVMDRGLDERSKRSPLTSRRSPASASPSLMVRVSLEALARRRRMRLYRRSQYSPEVDQ
QEPASQEQ
Download sequence
Identical sequences H2LFJ8
8090.ENSORLP00000004737 ENSORLP00000004737 ENSORLP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]