SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004819 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004819
Domain Number 1 Region: 4447-4601
Classification Level Classification E-value
Superfamily SET domain 2.09e-44
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1008-1068
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000135
Family PHD domain 0.0036
Further Details:      
 
Domain Number 3 Region: 957-1018
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000244
Family PHD domain 0.013
Further Details:      
 
Domain Number 4 Region: 405-458
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000105
Family PHD domain 0.0077
Further Details:      
 
Domain Number 5 Region: 351-409
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000193
Family PHD domain 0.0046
Further Details:      
 
Domain Number 6 Region: 1090-1148
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000111
Family PHD domain 0.012
Further Details:      
 
Domain Number 7 Region: 1658-1705
Classification Level Classification E-value
Superfamily HMG-box 0.0000154
Family HMG-box 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004819   Gene: ENSORLG00000003857   Transcript: ENSORLT00000004820
Sequence length 4601
Comment pep:novel chromosome:MEDAKA1:20:2786014:2835898:-1 gene:ENSORLG00000003857 transcript:ENSORLT00000004820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEAHPQEPRDRGPPSLITRAGRNAQLAKAAHNSPAQDKRPRGRPRKDGSNGRPAPPPA
PPPPPPRSSRKKGRSRGQAQVENEESMDAAEKEEPQKTELSKIPEMTVEEEILSSVVKQK
NCCIEYQRSLSEDSGGSPTPILGHAKKRRKQCAFCYRGDEPLLGLGRLVVFGPTPGYIPL
HILNRRTSSDRDSDCHEHCFHDSQAPPTWSNRPRRCSSPEQCALWCVCVSDESSSEFMKQ
LGPIGLPHDIDVQSLFDATGQCCAHLQCATWSEGVRRGEGQSLLFVDKAIDSGSIQVCAF
CRHLGASLRCQETGCTRSYHMPCAAAAGACQDWNQRRILCTQHARTGTSHTQSSSQCRLC
AGSGDSGGLLMCSCCGSCYHGSCLDPPVTPSPLSRVGWQCPQCRVCRSCSLQGDSGVLLC
ARCDKAYHAHCLTPPLDDAPHAAWTCKNCRTCRRCGVSSSGRWANNPFLCESCDLALPCP
LCDRTPDSHTPQDYLTCSCCYRCVHVECSVQAGEGRAGSEGYICFSCKPQESEEPISQSH
SPAPPTDVLQPRPPSNPDVHSADSPVQLLCSEVAQSPASGVCVPSPQHLTPPPPATEPSA
AVSLSDAQPSPSQTHTDSPNSQLLHAKEIYQSPAESPADIQHICRRDSEKIHQSPVAHFE
EMVQSPTGPSEEITASTAASLKEIQESPKSPTEESPAAPLDEMVLSPASPAEKVLTTLEP
CLAEENYPQSPSEPQQCSALSSEKACGAPEPQPGVNQDRDDSSDQKSAPSSQEFLPNPEQ
SPTDLNKSPNIGSEENQPSPVSSPKEIAHGSVISAAEAAESQAPPTVLPFTPKIGMGKPA
ISKRKFSSGRARVKQGLWWSSRRTLSPPSSSQDSMGEAGWESSKLDSPLWSSTVGRGSGF
PGRRRSKPTEDHGRFSCDNSKEVMGFYCVLQTGFVEPFQTKEEEENSMHNTVVMFSTSDH
FTLKQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVNIKITRVILTKGWRCLECTVCEA
CGDASDPGRLLLCDDCDISYHTYCLDPPLHTVPKGAWKCKWCVWCVQCGSTSPGVHSDWQ
RNYSLCGPCCSLSRCPACQQAYAEDDLILQCQQCDRWVHATCQGLCTEDEVEVAADEGFD
CSLCKAHERGTYGRAEALGPHVPHIMSKIREPDTKIYTQDGVCLTESGLSQLQSLVEPLS
SPRRYRRCKPKLKLRITNQNSVFVLQTPVHGDLSLEQEHGRGQQCSVDPQGELDCDMKSD
SSPERDRVLDDDLTKDSEVCDNSKKRKRKPYRPGIGGFMVRQRGGKAGPSRMKLCRKDSM
EGEANKTLTSEPLGMLDAEVSMETAPCAGPVMDKVKRRYRKKKGKLEEAFPSYLQEAFFG
RDLLDRSRQLEKAVGGEVQGSLQTGVATDHIKVPVNGSQGLHTGLSASAMATNRKQGTLP
ISEEALVDLSDVLNTDPHILATGHAAGLDINSMSDNPSLTSDPAGGCSRGLKVAQDEPLD
AILSPELDKMVSDGAILGRLYKIPELEGKDVEEVFTAVLSPGSRSSQPDPNQHAHASAVT
KLHTQAAAFPRLPLMNGLMESAPRFPMIPGGPQGEAGFRMAHPEGPGSTPVQGTAPASAS
ASQAAECEQDGLSTAQRGMLKWEKEESLGELATVAPVLYCNTNFPHLKEQYPDWPTRVKQ
IAKLWRKASSQDRAPFVQKARDNRAAQRINKVQLSNDPMKHLQPSQQQQQTQPPPPGAFD
PVSMELEMSFKDPLRPRESEQEQEWKMRQQMRQKSKQLAKMEATQKLEQVKNEQRQQQQL
LSSQRRPDCLSPESCSLLDHTHQSGSGDSTSPLHLPPGGRQHPNLQGGSAPADDVFLRPQ
APAPSGLSSLPHSPHASSPLHQPPSSPQMFSPPSSRPSSPWDPYSKVPGTPRPQTAPTPQ
LQQRGNSLTSSPSHDAMNSPIPSPDSKDAPRVPGPQTDPPSSLGNSSCLILLTGLQQSRS
GMLSPSSGIRTLDTHQRTNTRGDVFKAPMPPQLQLQQEVLGSTAGGRRDPSRPADLGYSL
AQPQQDLSFPSSPLSGLGSPHRSPYSQAPGTPRPDCSDPFSQQSPLSSRPSPDPYSNPQT
PGTPRSHSDPSYLTTPPALRLDHYNQQPATQRPSPSHPPLEPYASNPGTPRPSDRIPRSP
VNQRSSDPYCQPVGTPRPPTEPYTQQPSTPCSHKSQESFSQTAGESFLPQHGACGTSPLT
LGLSTEPGAFTPTPHQVRERSQSDATAGDRHLYSHSSCPSQRSPGKQPDSFPRTPKHLGN
PDEASLNPGQDPFEQGHMTRGSSQTESKTANMMSAAPSLDGPMSVLADSEEKLRQRQRLR
QLLLWQQQQKNALRQEKALQEPPAPHSWSQDNSSSAPTAAGFGRPPPPYPGTVRPCGPPT
PRFPTRFPVEQQSGFTSMEDTFPRQSMPRELAVRPPDVRFGALTGVQESLLHHPQGQAEG
HPVQMRRPADFSNIHPMMGTNMMPGSLPLGLPQPFIPRPHPVQQHNMPYIELRHRAPESR
LRLPFPLSATPDLKGPLLNPRDPHTAMVRAGHGPLRLGDTMLGQQMVMSGGIEQLSQQHM
AHSVALGQSGETTMPGPDGIEHLDGEDSAVKDLEDVEVKDLVDLNLNLDPEDGKEDLDLG
PNDLHLDDFLLSGKFDLIAYAMDMVNEELDLGEPVEEKEGREKRDGSGSSKRTESHAHLP
EKVKQEGEGAMKTESGSVLSAAQLPTKHLRGPAPPGGEGVETGLPGVVNKAQAWPGPPSL
QVSSLYCYRYIRGQILHLTFPLVTSSGHPPVFQQQRPFTPSPHPHTNLGGTSGPAHPVPV
QPHVLLTPQSQPASSTQAQTQSQNQNKARPLLLEEQPLLLQDLLDQERQEQQQQKQMQAL
IRQKPASEPVLPNTADFDSIPDPIMKAKMLALQGINKVMSQGSLGLNPMVINRYHHSPAP
VAPGPEGPLQPPQVVPQDGKLNPQLVRRNPPSSGSGFVNESQRRKYEEWLGETQQLLQMQ
QRLLEDQISTHRKAKKALSAKQRTAKKAGRAFAEEDAAQLRYISEQQGVVQKQLEQIRKQ
QKDHTELIEDYKNKQQRPLPLPETPQKTLPQPLAPIPPHQGGPTQSRLPNASPGWNPGAG
PPRPVGQRMPLHLPPQMTPRLPNNPQTASTMVPPLTPPTAAFTAGPRGPAGGLGGTSGDG
TAPTPQVKFDDNNPFSEGFQERERRERLREQQERQRVQLMQEVERHRALQKKLEQQDLEP
SGSVAKGVSSTPGGDGLTHLTFLSSEPGLDLLQSSSSSSRTTLQHQGQAGRPFPPQTGLQ
QGFTEGGRDVASSLQNRQRLTALPGATAQSQRLTAATPMTPSQPQCHHFEHDSSSSSPLN
PPPSSFPCAAGSPASLLQMYSDITTEDKPTKRSRKKEGEDTAGGAKTPLSPHSDITAPPT
PAVSDTSSSTPTHQAETQFPQGFPGLAPSYELERQLSASSVAQKRAPSSPTICVKVRLTR
TQQPLKSNRVSAVPVLGSEVTLIQQEECMEMRTCGGGVVKMEEGGGDGFSSSLQGGDRGK
ELLRHLLKEKASPASTPSPTRHAPPPACRQLSNDSLRSEEEEGPGSLVLRDSSGAELLKK
NQRCRRPARPDKDRAPTKNKRRKKEEEEKSLHSSSDPLVTHLRQQNNLSNPPTPPASLPP
TPPPVVRQKMVNGFASTDELSRKDVSEQEGEAAVKGPLKQKGDGLQAINPPSKTVDVPAS
LPTPPHNNQEELRVQDSSERNSPEGFVPSSSPESVVDMEVSRYPDLSFIKLEPPSPCPSP
TLPITPCAGGKGSAVKQEVKTEPNHQTPLPCSNTDLVAIAITLNPVAAQNVQGVMAAVAE
LLRVPVPANFQLSRAAGPEQSSLALLARVRVPLPQVRPVTMVMGLTWGCAMFVQAAVGCR
AQRPAAGSRPQCCIHCKAVLGNRLHVVQEFKQDGLSKPGSSLMFCSPNCSALYSNLQSRP
TGSKPEVPELLSGTDHNPSSRAQHQYTNNMSSIAASAITMETQPRTDSLKVKVKLKPHPR
ALPPGEDSPTCRHGKKMKTCRWRRWSVSITFSRGPCAPNEEVAMPTEEEVDVLLQKLGTC
LRPDSLPKDQRRCCFCHQQGDGQTDGPARLLNLDLDLWAHLNCALWSSEVYETQAGALIN
VELALRRGLTLRCAFCHQTGATSGCNRLRCTNTYHFTCALQAHCTFFKDKTMLCPLHKPS
DPYDSELRCFSVFRRVFVQRDEARQIAAIVQRGERQHTFRVGSLLFRTVGRLLPHQISTF
HNETAIFPVGYHANRLYWSMRHSNRRCKYMCHIEEVGGQPLFKVKVVEKGYEDLVLTGPS
PKAVWDQILEPVAQMRSSSGTLKLFPAYLKGEDLFGLTTSAVSRIIESLPGVEACERYTF
RYGRNPLMEWPLAFNPSGSARSEPKPCQAKRYDLTANLKNNEGFSENFSFSIKGGESVAA
AHQGRHSKAAQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKCTMVIEYIGAIIRSEVA
NRKERLYESQNRGVYMFRIDNDYVIDATITGGPARYINHSCAPNCITEVVNVEKENKIII
SSCRRIQRGEELSYDYKFDLEDDQHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences H2LFS9
ENSORLP00000004819 ENSORLP00000004819 8090.ENSORLP00000004819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]