SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004979 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004979
Domain Number 1 Region: 352-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-66
Family SPRY domain 0.00000946
Further Details:      
 
Domain Number 2 Region: 135-196
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-16
Family B-box zinc-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 12-79
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000309
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004979   Gene: ENSORLG00000003985   Transcript: ENSORLT00000004980
Sequence length 550
Comment pep:known chromosome:MEDAKA1:18:6413231:6416862:-1 gene:ENSORLG00000003985 transcript:ENSORLT00000004980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPGGLLSEVQFQCCICQDVFSEPVSIPCGHSFCLTCITSHWDDSAVISCPKCQTAFHG
RPEFCENSFAKEMSEQIRSRRQSGVTPLTAKTTPCDVCVTQQAKALKSCLVCLTSYCERH
LQPHLKVTSLKKHKLTDPVAMLQNRVCKRHQRLLELFCRNDQRCVCVLCNETDHKGHDTV
PLEQESSEKKAHITRIEADVQQMIQRRVQQVQEIKRNIEQSKENTNRDIEESSAVFAALL
RAVERSRAELEEVMERRQAQAEERAQRFITELEEEIHQLQKKRQEMQLILQSEDHIHILQ
RFPALSSPPSVKPCSDLLVHSDTCLGAVRRALATVQQQLQEEMEKLSMQDHERIQKYAVD
VYLDPKTANPWLAVSHDGRRVQDGEMEQDLPDASERFDTAPCALALRGFTTGRHYWEVEV
GDKTAWDLGVAQESVSRKGVVTLSPQDGFWAVCLRNGWEYRACASQAELLSLSKRLQVVG
VFLDYEGGTVSFYNADTKTHIYSFAETPFTQAMYPFFNPEMSYNGTNKSPLIIRPASVVY
SSRDLEDITI
Download sequence
Identical sequences H2LG86
ENSORLP00000004979 8090.ENSORLP00000004979 ENSORLP00000004979 XP_020567273.1.28442 XP_020567274.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]