SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005162 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005162
Domain Number 1 Region: 2174-2330
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.17e-33
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 2935-2992
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.63e-16
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 2646-2703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 4104-4162
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000109
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 3906-3964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 6 Region: 3678-3735
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000122
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 7 Region: 3095-3145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 8 Region: 4863-4920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 9 Region: 3289-3346
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 10 Region: 5028-5077
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000116
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 2813-2862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 4047-4105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 13 Region: 3741-3786
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 14 Region: 2871-2935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000124
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 2496-2535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 2593-2646
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 17 Region: 1635-1673
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 18 Region: 1455-1496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 1374-1409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2554-2592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 445-511
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000801
Family ATI-like 0.037
Further Details:      
 
Domain Number 22 Region: 1925-1980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000965
Family ATI-like 0.053
Further Details:      
 
Domain Number 23 Region: 3445-3492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 24 Region: 1499-1536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 4263-4308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 26 Region: 1273-1336
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000245
Family ATI-like 0.023
Further Details:      
 
Domain Number 27 Region: 3155-3196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 28 Region: 1813-1862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 29 Region: 4813-4860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 30 Region: 806-875
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000441
Family ATI-like 0.038
Further Details:      
 
Domain Number 31 Region: 1535-1573
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 32 Region: 3201-3254
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000491
Family ATI-like 0.045
Further Details:      
 
Domain Number 33 Region: 3514-3563
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 34 Region: 1722-1757
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 35 Region: 4920-4980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000687
Family BSTI 0.031
Further Details:      
 
Domain Number 36 Region: 2343-2379
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 37 Region: 4657-4711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 38 Region: 4166-4222
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000262
Family BSTI 0.052
Further Details:      
 
Domain Number 39 Region: 2992-3058
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000556
Family BSTI 0.027
Further Details:      
 
Domain Number 40 Region: 1862-1922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 41 Region: 4356-4414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000955
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 42 Region: 4470-4527
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000113
Family ATI-like 0.016
Further Details:      
 
Domain Number 43 Region: 2765-2829
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family VWC domain 0.022
Further Details:      
 
Domain Number 44 Region: 2018-2076
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 45 Region: 1413-1452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 46 Region: 975-1024
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000293
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number 47 Region: 3985-4036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000392
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 48 Region: 1676-1710
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 49 Region: 865-932
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000931
Family VWC domain 0.016
Further Details:      
 
Domain Number 50 Region: 5083-5145
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000109
Family ATI-like 0.028
Further Details:      
 
Domain Number 51 Region: 2730-2775
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000392
Family ATI-like 0.076
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005162
Domain Number - Region: 4723-4776
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000126
Family ATI-like 0.076
Further Details:      
 
Domain Number - Region: 3356-3407
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000126
Family BSTI 0.094
Further Details:      
 
Domain Number - Region: 1768-1798
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000471
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 4313-4369
Classification Level Classification E-value
Superfamily FnI-like domain 0.000502
Family VWC domain 0.032
Further Details:      
 
Domain Number - Region: 3571-3627
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00213
Family BSTI 0.048
Further Details:      
 
Domain Number - Region: 2074-2137
Classification Level Classification E-value
Superfamily FnI-like domain 0.00272
Family VWC domain 0.045
Further Details:      
 
Domain Number - Region: 5138-5202
Classification Level Classification E-value
Superfamily FnI-like domain 0.00471
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 4416-4461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00589
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 3789-3847
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0196
Family ATI-like 0.054
Further Details:      
 
Domain Number - Region: 509-549
Classification Level Classification E-value
Superfamily FnI-like domain 0.0262
Family Fibronectin type I module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005162   Gene: ENSORLG00000004121   Transcript: ENSORLT00000005163
Sequence length 5306
Comment pep:novel chromosome:MEDAKA1:20:3113226:3264092:1 gene:ENSORLG00000004121 transcript:ENSORLT00000005163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIIILLGLHTAMGLGQWCEHTVEDRVKHVLSPRLQLEVSCSAVYQYNMDGWRLDVDRM
RNKHGGDDGIALYYRQSGQKASCFLFKPPEMESHVVNRTVRGCCEGWAGPHCTQGVSLYG
RCFSTWNCEEFPGLHNSSLMPIEKCCSTLWGLSWKNASDQTCLSCTYNLLTDVKTFHVVR
SGLLGTSRAPRASGTCMSWGGAHYRTFDGKHFHFQGSCTYLLASSTDGTWAVYISTVLKM
MLGLDLISIQQKNLTLNSIPVPHGKPLFQNGISVHWLGDFVFVESGLGVRLKFDLINTVY
LTVTAEHLAATRGLCGVYNNNPEDDFRTVDGTVSPYAASFGNSWRVADHTNEDCSDAAEL
GHSCDIVEDLTLRRQAESVCHQLLENPFTHCHFRVDPAAYIDTCLYLYCSLPTRERDGGA
CDTLATYARECAQQHIIIMWRTPSLCGRVCPRGQVFSDCVSSCPPSCASPHPPGPAATMA
QCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRRLTYQPGDSIQQRCNTCVCRSGQWQC
TGERCAGQCTLVGALQVTTFDKKKYSLQGGDCAFIAVKDFVDRKLVVTMRCGECSTGGPQ
QGCLKEVSITALSTTVTITDTGTVTVNGVRQTLPVVSSDLAVHRASSSFILVQTFGALVL
WHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPCTL
PKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDVVEKEPYFRLCLSEVCACALQRSC
HCTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDS
SGEIGQRVCVPGCQCPTGLVQDHLGQCVPVSLCPCVQDDKIYSPGTILQNNCNTCVCKHG
AFNCTQEHCKSVQQCPGSLVYSPRSCMLTCSSLDHQGQQQSSSVTKPSCREPLSGCVCPQ
GTFFHGDRCVLPDECPCHHNGQVYYTNETITKDCNTCVCQKRRWHCTRLVCDGVCVATGD
PHYVTFDGRRYSFLGDCQYVLATETSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHL
LRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLR
GQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPCALNPHR
VTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECN
RRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAG
TIHHGDGCILPLDCPCEWEGSMFPPGTSITQRCQNCSCVEGLWQCEGVACPASSPPCLEA
EFACATGRCIPSQWLCDNEDDCGDGSDEICPSTCSVEQFRCDSTPSGPCLNLALRCDGNP
DCADRSDEDFCGPSLPMPLCPAGEFQCANGKCLASSHVCDGRPDCGFADGSDEQDCGVVC
NDGEFLCPGRRCILYLHRCDGHDDCGDFSDERGCMCAPGEFQCPVGNCVPAHRVCDGHRD
CPAGTDEAVCPRKGTQIQTTSPIADFSRVELVLQCVYFQDCRIGIVSDILRHTLSVSPSS
PSCSRPAFPNPLVMKKSCRFNEFSCASSGQCVPRAWRCDGESDCMDGSDEQDCGGLCGFG
HVPCLSQDQCVHYLQLCDGTPHCKDGSDESVNNCGSSQIPSCPGSFPCDDNTCVNVSQVC
NGVLDCPKGEDELVCVLYLSPPERTNTSISCSEYTCMDGTCVSFNSVCNSVEDCPDASLT
ALAGSTDEQSCRAWSSWGPWGPCSTSCGTGSMSRERSCPHGDPLRHCRGQKIQHQPCFRT
TCPVDGQWLSWVSWSNCSTPCGGVQVRQRSCTPPRYGGQDCSQLPGPSNLSVQIKPCPAD
GCVEARCPPNLVRHSCGPCPMSCAHISSGTSCDSPCFSGCWCPEGQAMNHMQQCVSPDEC
MCEVAGVYYWPGQQIKTDCKLCVCERGKPQKCQPIPDCTVHCGWSSWSEWGDCLGPCGVQ
SVQWSFRSPNNPSKHGNGRACRGIHRKARRCQTAPCKECKYQGQTHTVGDRWRSQPCQLC
RCLSNLMVECTLYCPYDAIGCPPGLSLVHEEESRCCYCQDNGTAVTVIPGTVTSKPAEGA
PPLIPTYPLPSGDKCWVPLGVQILPNSSFTASSHQAGHPPEAARLHWWDPHEALQGWSPE
PEEYKELPEQGPDGSTNSLYLQIDLLKPYNITGVLTQGGGAFGTYMSGFYLQFSQDGRRW
FTYRDVFRGNRDDQGVAENRLDRMVLAQFVRLLPHDFQNGIFLRLEIMGCGTQPPTKTSS
PSSCPTGHFFCPPPGGCIYAELRCDGVRHCPTGEDEDGCVPHDVTTQLYTPTPSPLRTPS
VAGVTTVRKHPHKTFSKLVFEEVYGFWLLGASRFAVPSIQNGLPGSHAKEKTSRGNPRFV
KASAGYHLLMTLKNPLLSKELLTPPSVTTSQPGKVPVQNCRPGQFLCQHSGECISMSVLC
DGQPNCKDQSDESNCGITPSTTARPTVTSQRPLAPSRCSPKQFSCTSGECIRLDRRCNLL
RDCVDGSDEGDCVDCIMSPWTAWSSCSVTCGLGSLFRQREILRDALPRGSCGGAQFDSRA
CFPQACPVHGHWSEWSEWSVCDALCGGGISTRNRNCSSPPPKNGGRDCYGMTLQSQSCNH
HPCTNYTDIHRGCVGGMVLVTQEDCQTGRVGPCPSICSDLSMSSTCTASCIEGCRCSSGL
YLQEGRCVNSSQCVCLWNGRTVQPGQVVKRDHCTMCICKDGQVICDPSTCLATCSWSAWS
QWSPCDVSCGVGLQQRYRSPVNPPGSIRVQLCPGDSTEARSCSSPCVPGTPDGVWSQWSG
WSECSKTCFSHVDDVGIRRRFRSCSQTHVSLNHTHNPFLCDGDKEEQEPCNTVQCPVHGA
WSPWSPWSQCSLECDSGVQTRMRVCSSPAPQHGGNSCLGPHIQTKDCNSQPCSGVCPEGM
AYMTSADCEAQGGACPRVCLDMTSLEVQCATVCYDGCYCAPGFYLFNSSCVPLAQCPCYH
MGEVYPAETTLSVDACNNCTCINGTMECGSISCSVDCGWSSWTQWSSCSRTCDVGVRRRY
RSGTNPPPAFGGHPCEGPRVGIDTCSIEPCLGVKEPWTAWSECSVTCGGGYRTRTRGPIR
IHGTAQQFSACNLQPCGEGRFCPVGQEWKQCVGRPQSCADITMNLSSNCTPGCQCPHGTF
LQDGMCVPESDCRCHVDGVQYKPGDAVNQNCNNCTCERGRLVQCSQVNCSVEGQWSEWTP
WGPCSLSCGSGIQSRYRFCASPQSSSSGLPCLGPHRHDQVCILTPCNLSPCSEVPGTAFS
SCGPSCPRSCDDLAHCEWKCEPGCYCSEGKVLSVNATVCVARENCPCLDLNTGQRLKPGE
ITRARDGCNNCTCVDGRFNCTREACPVSGGWCEWSEWTSCSRTCGAESVSRYRSCSCPEP
KAGGDHCPGEQEMHNGVGVQIQRQPCPVITFCPVHGSWSSWSEWSECDACSGSSTRTREC
SSPPARFSGLPCLGESRQSRGCHDNVTVCSDCIAGHQEWACGKPCPRSCSDLHGDTECLD
PPLCARSCGCQGDRVLQDGVCVAREECLCKYHNTSTNDVEKFPNASWVLVSPGDVITNDC
KNCSCEAGFMHCQSFPGCHVDGGWGQWAAWTQCSLSCGTGLQSRRRSCDNPAAQGSGRGC
VGAAEQTKDCNTQTCKDSVEPWLAWSQWSQCSVSCGGGQQSRFRLCSSPPCHGLSHQSKT
CNIQVCLDVGCPPGRLYRECERGEGCPFSCAQVSGREGCYSDGCEEGCHCPLETYQHRGL
CLSECPCLVDKKFLSALQRFSATTPSPLLFYNISEGMEVQHGNTVVHECSFCGCEHGRWN
CSLEYCPIDGGLSPWGPWSSCSLSCGGVGVTTRSRGCTQPSPAHGGRDCQGPLQETTYCQ
APDCPAFVAVYTTEEPVVTVPLKEDSGFSPWSTWSPCTKTCTDVQSPAVKSRHRSCVRPP
CSGNSHQDKPCNLPQCPGEICLGAECAGRNCTWTEWGEWSLCSRSCGVGQQQRIRTYFHP
GTNGSWCEDIIGGNLENRFCNIRPCRVNGGWSRWSPWSRCDKLCGGGRSIRTRSCSSPPP
KNGGQKCEGEKNQIKPCNTKPCEGKRCPASQEFDPCASQCPQRCSDLQQGLQCQGDTECQ
PGCRCPKGQLQQDGLCVEVWQCDCVDSAGQIWAAGSWHQVDCNNCSCSDGKLLCSNHSCQ
SACVWSSWSSWAQCSVSCGQGQRTRYRSLVPETEGVDCNFEEVQHKLCDKGRCPSLCLLN
EQELDLGDTWLQGECEQCICTPEGVYCQDIDCRDNLCRWSPWSPCSQSCGAGSASRRRLC
LCDEDDGDEGDSCPPEIEAEKNREETQLCYKQPCPGCPMSAWSVWSQCSCMSQRQQRYRV
ALTSATRGQQCNPVETQSRKCSLSQCDAAACEAPFVYSACGAPCDKQCSLLGRADLCLPS
AGCTPGCYCPEGLLQLNGSCVSPENCGCVYLQHHAAEKPPSTITVPQGGTITIDCSTCLC
HEGVLHCDTRECDGRKPAVILSEWSEWTRCSPCILSSSDQLSALVGGVVGGATMVSIQKR
FRACLDLDSGFPVPKEEESQCSGLLVDERLCPDQNICRDLCLWSVWSAWTACAEPCSGGV
RHRFRWPLKIPPGPRCRGRQTQSQSCNTGLCPGERCEDRERIYQQSCANQCPRSCTDLWE
HVQCLQGACHSAVGCRCPEGQLLQDGHCVPVAECRCGIPSGNGTLEFSPMEETTVDCNKC
VCVNGTLLCTKHPCPVYDSWSSWSSCSVSCGLGRMTRTRTCEDTEGGPSCGETTQTESCR
QQPCPVGCLLSDWSSWSECSALCGGGVMIRNKTVLQEAEAGGKPCDGPLEQHVICNTNRC
LPDCPSWQVYSDCSGSCPYTCEDLWPNTQCLPGPCTPGCTCPSGQVFYRGSCLDRADCPC
SVLSLPMEFQSWNESSEVLQPGATVQHLCNTCVCRGGVFHCTSETCDVDCEWSDWSAWSP
CSASCGTGQQSSTRSVLLPHQYGGAPCEGPNILTTTCSAADCVCSDGEQWRRSPSKEVPL
CERSCQDIYSSSPVNCSHPSESCVCREGLYRNAGGVCVIPALCPCHDQGVLREAGSQWNE
SCESCSCVNGRKLCQRRCPPLHCAEGEMKVEEPGSCCPVCRKPFPDELVPECQRYVQFQN
ITKGRCHLDNVEVSFCRGRCLSRTDVILEEPYLKSECECCSYRLDPAHPVHFLSLQCENG
EVEPVVLPVIQSCECTSCQGGDLSRR
Download sequence
Identical sequences H2LGR4
ENSORLP00000005162 8090.ENSORLP00000005162 ENSORLP00000005162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]