SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005545 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005545
Domain Number 1 Region: 43-177,358-584
Classification Level Classification E-value
Superfamily L domain-like 4.76e-44
Family Ngr ectodomain-like 0.028
Further Details:      
 
Domain Number 2 Region: 654-801
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.41e-40
Family Toll/Interleukin receptor TIR domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005545   Gene: ENSORLG00000004420   Transcript: ENSORLT00000005546
Sequence length 810
Comment pep:novel chromosome:MEDAKA1:10:11853738:11856207:1 gene:ENSORLG00000004420 transcript:ENSORLT00000005546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAPSFFVLSLSRQSMRLSAAVLCATAMLLGGQRCALLPGSMVDRSSKNLSSVPGDLPPS
AVSVDLSRNHIHQIHKGDFQSVPMLRFLNVSWNGLEHIDAETFLDTPHLEYLDLSHNILM
NLSGQRYLVNAGNLVELNLAWNMFLNMTLGEEFSLLVKLKGLTIGARNIGVGDFKNIARL
KLQSLTLFLEEELGYEVGSLINVNAKRLSIVFVDQTVNSGLISDALSVFDEVEMRNLTEG
FDDLTTQLRKKPECRTSNLTVSDMAIDWRNLTEFLNVALQTSIIHISLTDATINKPPYFD
TKVAQTARTKTFTLRRAVVSSFFFSQEAMYNFFINLPVQFLAVLETSIIHMTCPEKPSPV
VEIDFSSCALSDSLFSRIKGQETIECETLTNLTKLSLADNNLKNIQLLSERVQHMISLQH
LDLSLNSLVYDGKLCRWPPSLTVMNLSSGGLTEQVFECLPRGLERLDLQNNQISVVPTSI
YKLTKLSSLNLNSNRLRDLPVCNTFPMLNELLLKSNSLHAPSVNNLENCSILKTLDVSHN
PFTCTCSLRDFIKLGISTEKATSPIELLNWPQDYYCTYPEELRNSPLKDFWLSEVSCNVH
LLAATILVPAGALIISIVLLCHHLDIPWYMSMIWQWLRAKHRARTRQVRPEDLLGVEFHA
FVSYSQHDVDWVKNFLLHNLEGSAGGLKICHHEKNFVPGKTIVENIMACVEKSRRSVFIL
SAHFVKSEWCHYELYFASHQGLSLGTDGIVLVLLEPLPQYLIPNKYYQLKSMMLRHTYLE
WPQDRAKHRLFWANLRAALQADLPNLSVTD
Download sequence
Identical sequences H2LHT0
ENSORLP00000005545 8090.ENSORLP00000005545 ENSORLP00000005545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]